SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_003451567.1.81392 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_003451567.1.81392
Domain Number - Region: 69-154
Classification Level Classification E-value
Superfamily MetI-like 0.00523
Family MetI-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_003451567.1.81392
Sequence length 185
Comment ECF transporter S component [Clostridium perfringens]; AA=GCF_001406415.1; RF=na; TAX=1502; STAX=1502; NAME=Clostridium perfringens; strain=2789STDY5608889; AL=Contig; RT=Major
Sequence
MRNSKSLKLTIMGIGIALNIIGAFIALNLRLPIYLDSIGTIMVGFVLGPVYGMATGVLGS
VVSGITFDIYSLYFAPVQIFTGFFAGYFYEKGLMKGKKLFLSVFVMTLFVSFTGACLTAY
IFGGITSSGSSYIIVILNNLGVNPVVSAFITQFLTDYCDKLVAVLIMLQVVVRLPKNILL
RVQNN
Download sequence
Identical sequences A0A0H2YUG9 A0A173XFW0 B1BIL4 B1BPM7 B1R385 B1V098
gi|110801101|ref|YP_696682.1| 195103.CPF_2259 GO.10749 WP_003451567.1.10161 WP_003451567.1.2058 WP_003451567.1.22226 WP_003451567.1.24595 WP_003451567.1.27257 WP_003451567.1.27537 WP_003451567.1.31832 WP_003451567.1.4402 WP_003451567.1.50147 WP_003451567.1.50713 WP_003451567.1.5667 WP_003451567.1.81392 WP_003451567.1.90682 WP_003451567.1.98368

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]