SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_003452521.1.23119 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_003452521.1.23119
Domain Number 1 Region: 298-461
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 6.81e-42
Family Histidine kinase 0.0023
Further Details:      
 
Domain Number 2 Region: 225-309
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 3.34e-19
Family Homodimeric domain of signal transducing histidine kinase 0.00048
Further Details:      
 
Domain Number 3 Region: 190-238
Classification Level Classification E-value
Superfamily HAMP domain-like 0.00000000157
Family HAMP domain 0.0058
Further Details:      
 
Weak hits

Sequence:  WP_003452521.1.23119
Domain Number - Region: 80-164
Classification Level Classification E-value
Superfamily Sensory domain-like 0.0011
Family Sensory domain of two-component sensor kinase 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_003452521.1.23119
Sequence length 471
Comment two-component sensor histidine kinase [Clostridium perfringens]; AA=GCF_002018235.1; RF=na; TAX=1502; STAX=1502; NAME=Clostridium perfringens; strain=CP15; AL=Chromosome; RT=Major
Sequence
MKSIKTRLMKNFLVLLLSTIIIVSAMFLIFISRYYYQNTEEILLSQINISVDFYKRYLSN
VSLEENVYEDVDIFWKQTDAQVQIYNLKGQLIMDSIGLEPKEYNTPVDVKRALEGDTAKW
VGTVPDYTGKVMAISAPLRNSSNEIVGVIRYISSLRNVDNFILNFFLVFLVIGLTVLAIG
IILSYFLANSIVNPITELIKVSEQMAKGNLKVRNKIVTNDEIEKLADSLNIMAEEIENRE
ILKNEFISSVSHELRTPLTSIKGWAITLNNDFTDRETLKMGFDIIEKEADRLSNMVEELL
DFSKFVSGKIKLKYEEINLKEFIEYLRLYMNPRAEREHKELILKGITEDFIIVGDKDRLK
QVFINIIDNAFKFTHENEKITIEFVYADEGIYINIIDTGCGISKEELPRVKEKFYKGKNS
KSQNGIGLSICDEIIALHEGTLEIYSELGKGTKVVIYLPKKLIRSVEDDLN
Download sequence
Identical sequences A0A0H2YVT1 A0A127EL94 B1BK59 B1BRN9 B1R768 B1V5B5
gi|110801437|ref|YP_696917.1| 195103.CPF_2503 IDP04302 WP_003452521.1.10161 WP_003452521.1.1075 WP_003452521.1.13323 WP_003452521.1.1394 WP_003452521.1.14338 WP_003452521.1.17789 WP_003452521.1.2058 WP_003452521.1.20964 WP_003452521.1.22226 WP_003452521.1.23119 WP_003452521.1.24595 WP_003452521.1.27257 WP_003452521.1.27360 WP_003452521.1.27537 WP_003452521.1.28470 WP_003452521.1.28529 WP_003452521.1.29129 WP_003452521.1.29428 WP_003452521.1.30163 WP_003452521.1.3228 WP_003452521.1.4345 WP_003452521.1.44743 WP_003452521.1.48074 WP_003452521.1.4818 WP_003452521.1.50147 WP_003452521.1.50713 WP_003452521.1.51349 WP_003452521.1.52260 WP_003452521.1.5234 WP_003452521.1.52659 WP_003452521.1.5667 WP_003452521.1.64066 WP_003452521.1.66593 WP_003452521.1.67534 WP_003452521.1.68380 WP_003452521.1.76352 WP_003452521.1.78174 WP_003452521.1.83225 WP_003452521.1.85755 WP_003452521.1.87374 WP_003452521.1.90682 WP_003452521.1.93653 WP_003452521.1.96543 WP_003452521.1.98368 WP_003452521.1.99566

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]