SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_003454394.1.30163 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_003454394.1.30163
Domain Number 1 Region: 28-297
Classification Level Classification E-value
Superfamily MetI-like 2.88e-61
Family MetI-like 0.00000613
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_003454394.1.30163
Sequence length 297
Comment sugar ABC transporter permease [Clostridium perfringens]; AA=GCF_001579765.1; RF=na; TAX=1502; STAX=1502; NAME=Clostridium perfringens; strain=JP55; AL=Complete Genome; RT=Major
Sequence
MQSKVQKKSGIVTTSELKYERKLRPAERRMAWISRIFIWFMLLVVLFPVFAVVSASMAKG
EVFTQTTLIPSAWTLENYAKVLTETNFLIWVKNSLIICVVVSVIQLLLTVPMAFAFSRLK
FWGRKNGLMMLLLLQMFPAAMSLPAILALAYRLDGMDHIITLIIIQAGAGAFNVWLLKGA
IDGIPKELTEAAYVDGASTFQTFTMIILPLLRNMLLVIFLFTFIGAYSEFIFASALLKSP
ESLTLAVGMQQFITNNFSANWTQYSAAAIMASIPIVAFATIAQKYMAKGLTAGSVKG
Download sequence
Identical sequences A0A0H2YSK4 A0A174FL63 B1BMP2 B1R7P3
WP_003454394.1.10161 WP_003454394.1.2058 WP_003454394.1.20964 WP_003454394.1.22226 WP_003454394.1.23119 WP_003454394.1.24595 WP_003454394.1.27537 WP_003454394.1.30163 WP_003454394.1.31832 WP_003454394.1.4402 WP_003454394.1.50147 WP_003454394.1.51349 WP_003454394.1.52260 WP_003454394.1.5234 WP_003454394.1.52659 WP_003454394.1.5667 WP_003454394.1.68380 WP_003454394.1.81392 WP_003454394.1.98368 195103.CPF_2650 gi|110800361|ref|YP_697030.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]