SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_003454987.1.22226 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_003454987.1.22226
Domain Number 1 Region: 14-47,76-134
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 0.00000000000000367
Family Single-domain sulfurtransferase 0.097
Further Details:      
 
Domain Number 2 Region: 145-279
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000002
Family G proteins 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_003454987.1.22226
Sequence length 356
Comment tRNA 2-selenouridine(34) synthase MnmH [Clostridium perfringens]; AA=GCF_000255475.1; RF=na; TAX=883064; STAX=1502; NAME=Clostridium perfringens F262; strain=F262; AL=Chromosome; RT=Major
Sequence
MFGLISYEEIYGHEDEYIFIDVRSQKEAFEEPMIGSVNIPVLLNEERDVVGTLYVRESAE
AAKEQGIEFISRRLPEIFKQVQELYRNKHGKKLVIFCARGGMRSGSLHSLLNSLGINCYK
LEGGYKAYRSFIINKIEEFSKEIDFIVLYGNTGVGKTEMLYKLEEKGYDVLDLEGCANHR
GSILGGVGLGDCNTQKRFDALVYDKLRHRNSNIVFIEGESKRIGRILIPDPLFEKMYEGA
KLKISADPEIRAERLVKEYTAFENVNEQLDEALGVLKKHISQERVEQYKDLVAKGDYKKV
ALELMEKYYDPRYGTSAKKKTFRNELEINDIENELFKLEEIYKEISEELREDVYEQ
Download sequence
Identical sequences A0A0H2YSL8 A0A173X4M1 B1R3F3
195103.CPF_2327 WP_003454987.1.100517 WP_003454987.1.20964 WP_003454987.1.22226 WP_003454987.1.27537 WP_003454987.1.30163 WP_003454987.1.31832 WP_003454987.1.39851 WP_003454987.1.43003 WP_003454987.1.4402 WP_003454987.1.50147 WP_003454987.1.52260 WP_003454987.1.5234 WP_003454987.1.52659 WP_003454987.1.5667 WP_003454987.1.68380 WP_003454987.1.81392 gi|110799836|ref|YP_696750.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]