SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_003458297.1.20964 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_003458297.1.20964
Domain Number 1 Region: 326-464
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.01e-22
Family Histidine kinase 0.0055
Further Details:      
 
Domain Number 2 Region: 244-324
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.00000000000000294
Family Homodimeric domain of signal transducing histidine kinase 0.0029
Further Details:      
 
Domain Number 3 Region: 201-250
Classification Level Classification E-value
Superfamily HAMP domain-like 0.000000119
Family HAMP domain 0.0085
Further Details:      
 
Weak hits

Sequence:  WP_003458297.1.20964
Domain Number - Region: 75-160
Classification Level Classification E-value
Superfamily Sensory domain-like 0.00667
Family Sensory domain of two-component sensor kinase 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_003458297.1.20964
Sequence length 476
Comment two-component sensor histidine kinase [Clostridium perfringens]; AA=GCF_001949375.1; RF=na; TAX=1502; STAX=1502; NAME=Clostridium perfringens; strain=JFP771; AL=Contig; RT=Major
Sequence
MKNNKIQINLNLKQKIILTNLLILAPIIIFIFIITYNALSKNLINNSIEYLLDKSRTTES
YILNLLSSNDSGDKEDIIRDNAPFIASTLSEKYNVRIQIISNSAQIIYDSSSDEVSLFGS
DINESLDGQTAYIVEKIDNVPTLFLSSPIFYKGKEYGAIRLILINTEAYEILRNTLTIFI
ISGLIAIVIAIFLINTFAKELVSPLMILKQKSKNISEGKFKEELHITSGDEVEDLANTFN
IMSENLDKYINEIKSAKLHQKKFFDNVSHEFKTPLTAIIGFSEIIPKLNDKEKIVQSSAL
IEKEGKRLLNLVEEILLLAKSNKNTFEIEYTYIDVKSLIEDCLKILKIKLDNYDIKVYRN
YESFFIYGDHDKTKQVFINIIDNAIKYSGCETLSISTKRSPNKMEVIIEDDGTGFIIKDE
YVNPKGNGLGIKICKDIMQSQNYGFNIESELDVGTKVTLSFSIGKNNEIKEEDFNE
Download sequence
Identical sequences A0A0H2YP95 A0A1U9V4U9 B1R890
IDP04189 NYSGRC-FDAO-ABG82744 WP_003458297.1.10161 WP_003458297.1.2058 WP_003458297.1.20964 WP_003458297.1.27537 WP_003458297.1.30163 WP_003458297.1.31832 WP_003458297.1.4402 WP_003458297.1.50147 WP_003458297.1.52260 WP_003458297.1.5234 WP_003458297.1.52659 WP_003458297.1.68380 195103.CPF_0225 gi|110799110|ref|YP_694688.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]