SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_003458341.1.68380 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_003458341.1.68380
Domain Number 1 Region: 3-209
Classification Level Classification E-value
Superfamily Heme oxygenase-like 9.94e-55
Family Eukaryotic type heme oxygenase 0.0000538
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_003458341.1.68380
Sequence length 214
Comment biliverdin-producing heme oxygenase [Clostridium perfringens]; AA=GCF_001949725.1; RF=na; TAX=1502; STAX=1502; NAME=Clostridium perfringens; strain=JFP981; AL=Contig; RT=Major
Sequence
MNSFMMDIKNNSNDLHAVAEKTGFLKRLLEGKASTESYAEYLYNLYEVYNAIEVNLEKCK
DNKVVKDFVLPEIYRAEAILKDLKFLLGENLNTMKPLASTRAYVARINEIGETAPELLVA
HAYTRYLADLFGGRTIYGMVKDLYKIDEEGLNYYKYETLSDGPEMKGFVMNYHNKLNNIE
LNEEMKERFINEVANSYVYNIAISNELDFIRFNR
Download sequence
Identical sequences A0A0H2YUM0 A0A174H1X0 B1BUF0 B1R8B0 Q0SWG2
gi|110802532|ref|YP_697538.1| gi|110801171|ref|YP_694668.1| 195103.CPF_0205 289380.CPR_0203 WP_003458341.1.10161 WP_003458341.1.2058 WP_003458341.1.20964 WP_003458341.1.22226 WP_003458341.1.27537 WP_003458341.1.30163 WP_003458341.1.35472 WP_003458341.1.50147 WP_003458341.1.51349 WP_003458341.1.52260 WP_003458341.1.5234 WP_003458341.1.52659 WP_003458341.1.68380 WP_003458341.1.81392 WP_003458341.1.90682 WP_003458341.1.98368

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]