SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_003459619.1.76352 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_003459619.1.76352
Domain Number - Region: 12-99
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 0.00586
Family FMN-linked oxidoreductases 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_003459619.1.76352
Sequence length 409
Comment peptidase U32 [Clostridium perfringens]; AA=GCF_001949405.1; RF=na; TAX=1502; STAX=1502; NAME=Clostridium perfringens; strain=JFP828; AL=Contig; RT=Major
Sequence
MRKPEILAPAGSLEKLKTAIDFGADAVYIGGSKLNLRAFADNFTNEQIAEGVKYAHDRGR
KVYVTMNVFPHNADLEGLEEYIVGLNDLNVDAIIVSDPSIIMTAKEVAPDLEIHLSTQAN
NVNWKSAKFWHSLGVKRIVLARELSFKEIEKIHENLPEDCDLEAFVHGSMCMAYSGRCLI
SNYMTGRDSNRGACSQACRYKYYLMEEKRPGEYFQVIEDDKGTYIMNSKDLCMIEYIPEL
VKSGIYSFKIEGRMKSPYYVAAIVKAYREALDKYWDDPEGYEFDQKLMDNLLKVSHRRYH
TGFYFGKSGEQVYESSSYIRDYDIVGVVRDYNEETKVATIEQRNRLFEGDTVEVLTPVGD
YYEIQMNDMKDEKDEKIDVANKAQMIFKVKIDKPVKVNDMLIKCKEANS
Download sequence
Identical sequences A0A0H2YQ26 A0A133NEF9 B1BXR8 B1RAE9 B1V3M0 Q8XJI5
WP_003459619.1.1075 WP_003459619.1.13323 WP_003459619.1.1394 WP_003459619.1.14338 WP_003459619.1.17789 WP_003459619.1.20964 WP_003459619.1.22226 WP_003459619.1.23119 WP_003459619.1.27257 WP_003459619.1.27360 WP_003459619.1.27537 WP_003459619.1.28470 WP_003459619.1.28529 WP_003459619.1.29129 WP_003459619.1.29428 WP_003459619.1.30163 WP_003459619.1.31832 WP_003459619.1.3228 WP_003459619.1.32463 WP_003459619.1.35472 WP_003459619.1.39851 WP_003459619.1.43003 WP_003459619.1.4345 WP_003459619.1.4402 WP_003459619.1.44743 WP_003459619.1.48074 WP_003459619.1.4818 WP_003459619.1.50147 WP_003459619.1.50713 WP_003459619.1.52260 WP_003459619.1.5234 WP_003459619.1.52659 WP_003459619.1.5667 WP_003459619.1.64066 WP_003459619.1.66593 WP_003459619.1.67534 WP_003459619.1.68380 WP_003459619.1.76352 WP_003459619.1.78174 WP_003459619.1.81392 WP_003459619.1.83225 WP_003459619.1.85755 WP_003459619.1.87374 WP_003459619.1.90682 WP_003459619.1.93653 WP_003459619.1.96543 WP_003459619.1.99566 gi|18310753|ref|NP_562687.1| 195102.CPE1771 195103.CPF_2024 gi|110799271|ref|YP_696457.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]