SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_003461122.1.27257 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_003461122.1.27257
Domain Number 1 Region: 1-277
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.3e-24
Family HI0933 N-terminal domain-like 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_003461122.1.27257
Sequence length 296
Comment monooxygenase [Clostridium perfringens]; AA=GCF_001052445.1; RF=na; TAX=1502; STAX=1502; NAME=Clostridium perfringens; strain=1207_CPER; AL=Scaffold; RT=Major
Sequence
MREYDLIIIGGGASGLLLAINGKKDGIKNILLVEKDPILGGALNSADYNISEKGNLTGIE
YKESLLKEFNELNIDVKLNTMVLKIEDSNEILCTSSEYGVEKIKGKNIIITNGGKEKSRN
AVQIPGDRTAGVLTVGMAKKIFGIKNMVPGKNIFIVGDSTLYMIQEDLKKHNIKVSGIIT
DKNKNEVFDLSENLYPGYEIVSIHGEGRVSSVTIKNDDEKKNIKCDTVIFAYPMISDGLV
ALRSGLKLNPSTTGPAVDENLETSSKNIYACGNAIYIHKSIEEIEDECKKLIKTIS
Download sequence
Identical sequences A0A0H2YT72 B1BNP9
WP_003461122.1.27257 WP_003461122.1.50147 WP_003461122.1.51349 WP_003461122.1.90682 195103.CPF_0412 gi|110800610|ref|YP_694869.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]