SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_003461855.1.23119 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_003461855.1.23119
Domain Number 1 Region: 4-274
Classification Level Classification E-value
Superfamily MetI-like 1.1e-57
Family MetI-like 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_003461855.1.23119
Sequence length 281
Comment ABC transporter permease [Clostridium perfringens]; AA=GCF_002018235.1; RF=na; TAX=1502; STAX=1502; NAME=Clostridium perfringens; strain=CP15; AL=Chromosome; RT=Major
Sequence
MKNRNKNLSFAAYPYVVWSAIFIVIPLLLIVFFSFTSKVDGRFVFSFENFQRLFEPIYFT
VFIRSIWLAVLSTVSCLILGYPIAYIISKLPIKRRNMLILLFILPMWMNFLLRTYAWMAI
LGRDGLINTLLGYIGIGPIKMLYTDGAILLGMVYNFLPFMVIPIYTVLIKIDKNLVNAAY
DLGANKAQAFRKIILPLSIPGIISGITMVFMPAVSNFVIPSLLGGGKYMLVGNLIEQQFT
TIGNWNFGSALSIFMMILILISMAFMSKYEKNGKEGGKQLW
Download sequence
Identical sequences A0A0H2YU33 A0A133N4I2 B1BPV9 B1V065 Q8XIZ4
gi|18310951|ref|NP_562885.1| gi|110800670|ref|YP_696648.1| WP_003461855.1.100517 WP_003461855.1.10161 WP_003461855.1.2058 WP_003461855.1.20964 WP_003461855.1.22226 WP_003461855.1.23119 WP_003461855.1.27257 WP_003461855.1.30163 WP_003461855.1.31832 WP_003461855.1.32463 WP_003461855.1.35472 WP_003461855.1.39851 WP_003461855.1.4402 WP_003461855.1.50147 WP_003461855.1.50713 WP_003461855.1.51349 WP_003461855.1.52260 WP_003461855.1.5234 WP_003461855.1.52659 WP_003461855.1.5667 WP_003461855.1.68380 WP_003461855.1.90682 WP_003461855.1.98368 195102.CPE1969 195103.CPF_2224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]