SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_003462958.1.27257 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_003462958.1.27257
Domain Number 1 Region: 3-102
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 3.4e-25
Family Single-domain sulfurtransferase 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_003462958.1.27257
Sequence length 109
Comment rhodanese [Clostridium perfringens]; AA=GCF_001052445.1; RF=na; TAX=1502; STAX=1502; NAME=Clostridium perfringens; strain=1207_CPER; AL=Scaffold; RT=Major
Sequence
MYKDIDITESIKLIDENKDLLILDVRTEEEYKEDGYIKNAKLIPLGRLLFSIDELDGYED
SPILVYCRRGSRSMQACEILEDNGFTELYNMMGGFSKLVNEGPKELWNK
Download sequence
Identical sequences A0A0H2YTX6 A0A174G8N7 B1BSF3 B1UZV2 Q0SQ11 Q8XHE5
gi|110802805|ref|YP_699796.1| WP_003462958.1.10161 WP_003462958.1.2058 WP_003462958.1.20964 WP_003462958.1.22226 WP_003462958.1.27257 WP_003462958.1.30163 WP_003462958.1.31832 WP_003462958.1.32463 WP_003462958.1.39851 WP_003462958.1.43003 WP_003462958.1.4402 WP_003462958.1.50147 WP_003462958.1.50713 WP_003462958.1.51349 WP_003462958.1.52260 WP_003462958.1.5234 WP_003462958.1.52659 WP_003462958.1.5667 WP_003462958.1.68380 WP_003462958.1.81392 WP_003462958.1.90682 WP_003462958.1.98368 195102.CPE2540 195103.CPF_2864 289380.CPR_2549 gi|18311522|ref|NP_563456.1| gi|110800917|ref|YP_697228.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]