SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_003468041.1.81392 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_003468041.1.81392
Domain Number 1 Region: 2-206
Classification Level Classification E-value
Superfamily Undecaprenyl diphosphate synthase 1.31e-51
Family Undecaprenyl diphosphate synthase 0.0000683
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_003468041.1.81392
Sequence length 213
Comment dihydroorotate dehydrogenase [Clostridium perfringens]; AA=GCF_001406415.1; RF=na; TAX=1502; STAX=1502; NAME=Clostridium perfringens; strain=2789STDY5608889; AL=Contig; RT=Major
Sequence
MRIPKHIGVIPDGNRRWAVENGLEKDQGYLHGIEPGLELFKLCQKLDIKEITYYGFTTDN
TKRPSYQKKAFIDACIKSVELIANEDCELLVIGNADSPVFPEELKKYTKRTTMGKGGIRV
NFLVNYGWEWDLNLLKACDIKSKNIYDNIQSKDISRIDLLIRWGGRRRLSGFLPVQSVYS
DIYIIDDLWPNFNKDHFFNALEWYKDQDITLGG
Download sequence
Identical sequences A0A0H2YU84 A0A173Z8T4
WP_003468041.1.100517 WP_003468041.1.22226 WP_003468041.1.27257 WP_003468041.1.31832 WP_003468041.1.39851 WP_003468041.1.4402 WP_003468041.1.50147 WP_003468041.1.81392 gi|110800504|ref|YP_696243.1| 195103.CPF_1809

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]