SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_003471623.1.10161 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_003471623.1.10161
Domain Number 1 Region: 78-283
Classification Level Classification E-value
Superfamily MCP/YpsA-like 1.5e-39
Family MoCo carrier protein-like 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_003471623.1.10161
Sequence length 360
Comment DNA-processing protein DprA [Clostridium perfringens]; AA=GCF_002012325.1; RF=na; TAX=1502; STAX=1502; NAME=Clostridium perfringens; strain=Del1; AL=Chromosome; RT=Major
Sequence
MKEVDLNYKIWLGSLKISNNIKVELLNQLGNEENIYIHRKDIEETGIKCASKFKNDINID
LNSRVINDINKKDYKIVTYLDKDYPKRLKNIDEPPYILFYKGDLERAEDTNVAIVGSRKC
DPYGKRCASLIASGLGKAGVGIVSGGAFGVDTEAHKKCVEENFYNVAVFGCGINLDYPVY
NRELYKKIIKNGCIISEFFPDTPPLRYNFPQRNRIISGLSEAVIVVQAGEKSGSLITANY
AVNQGKDVFAVPGDVFSSQSRGCNNLIKDGAGIFTNIGDLLNSIPFKIKKEGKCNKDGKK
EENSEINQLLLSILENNILHIDDIIRVTNIDTSIIYELLCELQFENKIEVIPGDYYTKII
Download sequence
Identical sequences A0A0H2YQZ9 A0A1U9V9F3
gi|110799380|ref|YP_696390.1| WP_003471623.1.10161 WP_003471623.1.2058 WP_003471623.1.50147 WP_003471623.1.98368 195103.CPF_1957

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]