SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_003512093.1.6965 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_003512093.1.6965
Domain Number 1 Region: 1-289
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 5.69e-96
Family Methylenetetrahydrofolate reductase 0.00000034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_003512093.1.6965
Sequence length 291
Comment methylenetetrahydrofolate reductase [NAD(P)H] [Ruminiclostridium thermocellum]; AA=GCF_000175715.1; RF=na; TAX=572545; STAX=1515; NAME=Ruminiclostridium thermocellum DSM 2360; strain=DSM 2360; AL=Contig; RT=Major
Sequence
MNLVDLFKKKKPVISFEIFPPKLDTPIESIFGTLEQFKELKPDFISVTYGAGGSAKDRTI
EIASKIKNEYGIESMAHLTCVGHSKEEIDALLTSMREHNLENILALRGDPPANQPDFDFS
NNAFKYANELIAHVRKQNRNDFCIAAAAYVEGHVNSKRLKDDLLYLKQKVDTGVDFLVTQ
LFFDNRLFYDFLDKTASIGITCPITPGIMPIFKADQIKRITYLCGASIPAKLVIMMDKYG
DNDEDMRKAGIEYASNQIRDLIDNGVDGIHLLTMNRPKSTREILTNIGLLK
Download sequence
Identical sequences A3DBL1
203119.Cthe_0099 gi|125972623|ref|YP_001036533.1| WP_003512093.1.16390 WP_003512093.1.19387 WP_003512093.1.31213 WP_003512093.1.60145 WP_003512093.1.6636 WP_003512093.1.6965 gi|385779459|ref|YP_005688624.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]