SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_003513536.1.6636 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_003513536.1.6636
Domain Number 1 Region: 1-209
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 1.3e-59
Family PP-loop ATPase 0.0000421
Further Details:      
 
Domain Number 2 Region: 381-464
Classification Level Classification E-value
Superfamily PheT/TilS domain 1.7e-23
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.043
Further Details:      
 
Domain Number 3 Region: 213-321
Classification Level Classification E-value
Superfamily MesJ substrate recognition domain-like 8.89e-17
Family MesJ substrate recognition domain-like 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_003513536.1.6636
Sequence length 470
Comment tRNA(Ile)-lysidine synthetase [Ruminiclostridium thermocellum]; AA=GCF_001692755.1; RF=na; TAX=572545; STAX=1515; NAME=Ruminiclostridium thermocellum DSM 2360; strain=LQRI; AL=Complete Genome; RT=Major
Sequence
MIDKVLETIKKYNMINNKDKIVVGVSGGPDSVCLLHILCKLRESMDLGLVAVHVNHMLRG
DEASGDEAFVENLCKKLNVELVTRRIDIKKLAKERRLSLEETGRIERYRLFEEVADNFGA
QRIAVAHNKNDQAETVLMNIIRGTGLDGLRGMDYIRGRIIRPLLGVERTEIENYCRIHNL
NPRIDSTNLENIYTRNKIRLDLIPYIEKLFNADIVNGISKMADLIKDDVSFIESRTDEIY
NKAKIKSDDKGVILDLNILKECHIAARKRIIRNSIKQIKGDIKGIATVHIDSITDLIENG
KTGSMLHLPHGVRAVKSYNTLKICLHELKEEDIYFNKEVNIPGITVVDEICGSLEATLID
VSADCFSIEDFTKVPDKSKVQFFDYDRLKEGIYLRNRRDGDVFRPRNSNGTKKLKEFFID
NKIPRETRNQIPLISTRKEIVWIIGYKISDKFKVTENTKIILKLSYDNSH
Download sequence
Identical sequences A3DHM8
WP_003513536.1.16390 WP_003513536.1.19387 WP_003513536.1.20586 WP_003513536.1.31213 WP_003513536.1.55520 WP_003513536.1.60145 WP_003513536.1.6636 WP_003513536.1.6965 gi|385780194|ref|YP_005689359.1| 203119.Cthe_2255 gi|125974740|ref|YP_001038650.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]