SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_003528052.1.66997 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_003528052.1.66997
Domain Number 1 Region: 6-97
Classification Level Classification E-value
Superfamily YccV-like 1.57e-35
Family YccV-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_003528052.1.66997
Sequence length 109
Comment MULTISPECIES: DNA-binding protein [Sinorhizobium/Ensifer group]; AA=GCF_002197105.1; RF=na; TAX=382; STAX=382; NAME=Sinorhizobium meliloti; strain=KH35c; AL=Complete Genome; RT=Major
Sequence
MKQRNAKFEIGQVVRHRMFPFRGVVFDVDPEYANTEEWWNAIPQEIRPEKDQPFYHLFAE
NDESEYVAYVSEQNLVSDDSDRPIRHPQVDALFEKADAGHYKPKATYQH
Download sequence
Identical sequences A0A0E0UCE8 A0A222H6H1 A0A2G7TFP1 F7X9C7 H0FXU7 Q92PT9
NP_385747.1.96377 WP_003528052.1.11889 WP_003528052.1.18618 WP_003528052.1.22199 WP_003528052.1.24285 WP_003528052.1.30341 WP_003528052.1.3038 WP_003528052.1.3110 WP_003528052.1.32135 WP_003528052.1.34728 WP_003528052.1.36091 WP_003528052.1.36292 WP_003528052.1.36834 WP_003528052.1.4234 WP_003528052.1.44594 WP_003528052.1.47143 WP_003528052.1.48083 WP_003528052.1.49828 WP_003528052.1.50755 WP_003528052.1.54190 WP_003528052.1.55094 WP_003528052.1.58221 WP_003528052.1.58608 WP_003528052.1.63001 WP_003528052.1.65778 WP_003528052.1.66997 WP_003528052.1.72343 WP_003528052.1.73540 WP_003528052.1.78492 WP_003528052.1.787 WP_003528052.1.79107 WP_003528052.1.80755 WP_003528052.1.83096 WP_003528052.1.83536 WP_003528052.1.86220 WP_003528052.1.89614 WP_003528052.1.90561 WP_003528052.1.90968 WP_003528052.1.92524 WP_003528052.1.94084 WP_003528052.1.96031 WP_003528052.1.99158 266834.SMc00949 gi|334316278|ref|YP_004548897.1| gi|407720589|ref|YP_006840251.1| gi|384529461|ref|YP_005713549.1| gi|470188599|ref|YP_007574910.1| gi|433613423|ref|YP_007190221.1| gi|15965394|ref|NP_385747.1| gi|384536211|ref|YP_005720296.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]