SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_003546929.1.35116 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_003546929.1.35116
Domain Number 1 Region: 13-111
Classification Level Classification E-value
Superfamily Enzyme IIa from lactose specific PTS, IIa-lac 1.23e-35
Family Enzyme IIa from lactose specific PTS, IIa-lac 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_003546929.1.35116
Sequence length 123
Comment PTS cellobiose transporter subunit IIA [Lactobacillus acidophilus]; AA=GCF_000786395.1; RF=na; TAX=1579; STAX=1579; NAME=Lactobacillus acidophilus; strain=ATCC 4356; AL=Contig; RT=Major
Sequence
MAEEKQTPEQKDQETLMAAMGLIANGGNAKSLAFEAIRLAKTGDIEGAREKLKESDKSLL
EAHNSQTSMLTQEAQGDHMHVTLLVVHSQDHLMNAITFRDLAGEMVDLYEKLYNSGALKK
EDK
Download sequence
Identical sequences Q5FKN8
272621.LBA0877 WP_003546929.1.23735 WP_003546929.1.25481 WP_003546929.1.35116 WP_003546929.1.39168 WP_003546929.1.44280 WP_003546929.1.4466 WP_003546929.1.47136 WP_003546929.1.60265 WP_003546929.1.63260 WP_003546929.1.66258 WP_003546929.1.68937 WP_003546929.1.73327 WP_003546929.1.74539 WP_003546929.1.75182 YP_193767.1.59247 gi|58337182|ref|YP_193767.1| gi|488767652|ref|YP_007937749.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]