SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_003624832.1.36696 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_003624832.1.36696
Domain Number 1 Region: 6-235
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 1.96e-30
Family Methylenetetrahydrofolate reductase 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_003624832.1.36696
Sequence length 249
Comment methylenetetrahydrofolate reductase [Acetobacter pasteurianus]; AA=GCF_000241625.1; RF=na; TAX=940265; STAX=438; NAME=Acetobacter pasteurianus subsp. pasteurianus LMG 1262 = NBRC 106471; strain=IFO 3191; AL=Contig; RT=Major
Sequence
MSLSRLSVELIPRSAEALAADVATVKAAFPAADTLNIPDLMRFPLRSWDAAALVRPQFGN
VIPHIRAIDIAPDAPLPGADQPGLEEILVVHGDPPADLSHRTYPNSTESIIRRYRREAPH
LKVYAAFDPYRRAPWKELEDVARKKEAGAIGFFTQPVFDLKLFDLCREWMQGECVFWGLS
PVIGPKSRSYWETTNHIVFPRDFSPTLDANIQFAQTVLKELAQEKGKAYLMPVRIKLEQY
LPALLDAVA
Download sequence
Identical sequences A0A1A0DDZ7 C7JBE9 H1UP07 S6DB77
gi|384052869|ref|YP_005485963.1| gi|384041244|ref|YP_005479988.1| gi|384062036|ref|YP_005482678.1| gi|258541323|ref|YP_003186756.1| gi|529231690|ref|YP_008392505.1| gi|384049759|ref|YP_005476822.1| WP_003624832.1.13261 WP_003624832.1.36695 WP_003624832.1.36696 WP_003624832.1.37930 WP_003624832.1.38618 WP_003624832.1.45580 WP_003624832.1.55019 WP_003624832.1.62313 WP_003624832.1.64431 WP_003624832.1.65311 WP_003624832.1.71918 WP_003624832.1.82089 WP_003624832.1.88241 WP_003624832.1.96488 WP_003624832.1.99323 gi|384056101|ref|YP_005488768.1| 634452.APA01_02240 gi|384118112|ref|YP_005500736.1| gi|384058742|ref|YP_005497870.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]