SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_003636113.1.41439 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_003636113.1.41439
Domain Number 1 Region: 12-115
Classification Level Classification E-value
Superfamily SH2 domain 0.00000000242
Family SH2 domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_003636113.1.41439
Sequence length 167
Comment hypothetical protein [Legionella longbeachae]; AA=GCF_002073455.1; RF=na; TAX=450; STAX=450; NAME=Legionella longbeachae; strain=FDAARGOS_201; AL=Complete Genome; RT=Major
Sequence
MEAMQKNELNSKIPIIFGLINSYQIHNLLEQHNAKTKESKAVFLIRDSSTYPGLLTISYY
CQEQDIVKHIRFGLTDKGWKTAPKPPHEPLKSDSPEIKEKYTLDKIKFERKMKQFINTAK
KLFEQHIRAESFKTLIMELKIHEFNLEGLIKPTRSQASQEKHFTDYV
Download sequence
Identical sequences D3HJY4
gi|289165652|ref|YP_003455790.1| WP_003636113.1.28247 WP_003636113.1.35775 WP_003636113.1.41439 WP_003636113.1.55568

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]