SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_003641531.1.13966 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_003641531.1.13966
Domain Number 1 Region: 4-196
Classification Level Classification E-value
Superfamily ITPase-like 4.45e-65
Family ITPase (Ham1) 0.0000148
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_003641531.1.13966
Sequence length 202
Comment non-canonical purine NTP pyrophosphatase [Lactobacillus plantarum]; AA=GCF_900080205.1; RF=na; TAX=1590; STAX=1590; NAME=Lactobacillus plantarum; AL=Contig; RT=Major
Sequence
MTKPQTLIIATNNANKAREFSAMLAPYDITIKTLADFPNIPEIKENGITFEENATKKATV
VVEATGLPAIADDSGLMVKALHGDPGVFSARYAGDHDDAANNAKLLANLGGVPEAERTAT
FHTTLVALKPSGEKLVVNGELAGRILIAPRGDNGFGYDPLFWSSKFQKSLAELTPAQKNQ
ISHRGAALRQLMTKFDEWWAKA
Download sequence
Identical sequences A0A0G9F718 A0A2J6U0U7 A0A2K3C3L1 D7VBA1 M4KKR7 Q88V20 R9X4D2
gi|513841627|ref|YP_008121599.1| 220668.lp_2267 644042.JDM1_1900 WP_003641531.1.100103 WP_003641531.1.100207 WP_003641531.1.100379 WP_003641531.1.100429 WP_003641531.1.100643 WP_003641531.1.101934 WP_003641531.1.1220 WP_003641531.1.12236 WP_003641531.1.12283 WP_003641531.1.12549 WP_003641531.1.1364 WP_003641531.1.13966 WP_003641531.1.14222 WP_003641531.1.15471 WP_003641531.1.16071 WP_003641531.1.17136 WP_003641531.1.17377 WP_003641531.1.17493 WP_003641531.1.17979 WP_003641531.1.182 WP_003641531.1.19463 WP_003641531.1.19859 WP_003641531.1.20190 WP_003641531.1.2169 WP_003641531.1.21914 WP_003641531.1.22404 WP_003641531.1.22467 WP_003641531.1.25460 WP_003641531.1.25482 WP_003641531.1.25870 WP_003641531.1.26444 WP_003641531.1.27617 WP_003641531.1.28208 WP_003641531.1.28597 WP_003641531.1.28802 WP_003641531.1.29036 WP_003641531.1.29793 WP_003641531.1.30329 WP_003641531.1.31165 WP_003641531.1.3126 WP_003641531.1.33461 WP_003641531.1.33465 WP_003641531.1.34542 WP_003641531.1.34594 WP_003641531.1.34840 WP_003641531.1.35369 WP_003641531.1.36601 WP_003641531.1.37110 WP_003641531.1.37210 WP_003641531.1.37234 WP_003641531.1.37302 WP_003641531.1.37888 WP_003641531.1.37993 WP_003641531.1.39741 WP_003641531.1.4007 WP_003641531.1.40915 WP_003641531.1.40917 WP_003641531.1.42053 WP_003641531.1.42956 WP_003641531.1.4363 WP_003641531.1.43944 WP_003641531.1.44129 WP_003641531.1.44182 WP_003641531.1.45255 WP_003641531.1.47368 WP_003641531.1.48352 WP_003641531.1.48891 WP_003641531.1.49466 WP_003641531.1.49499 WP_003641531.1.49644 WP_003641531.1.49875 WP_003641531.1.50091 WP_003641531.1.50648 WP_003641531.1.51711 WP_003641531.1.52115 WP_003641531.1.53222 WP_003641531.1.53564 WP_003641531.1.54321 WP_003641531.1.54513 WP_003641531.1.56089 WP_003641531.1.56224 WP_003641531.1.56240 WP_003641531.1.56426 WP_003641531.1.56520 WP_003641531.1.57 WP_003641531.1.59418 WP_003641531.1.59824 WP_003641531.1.60366 WP_003641531.1.60571 WP_003641531.1.61917 WP_003641531.1.62691 WP_003641531.1.6273 WP_003641531.1.64570 WP_003641531.1.65354 WP_003641531.1.65980 WP_003641531.1.66154 WP_003641531.1.6617 WP_003641531.1.66243 WP_003641531.1.68320 WP_003641531.1.6836 WP_003641531.1.68648 WP_003641531.1.68947 WP_003641531.1.69461 WP_003641531.1.69847 WP_003641531.1.69852 WP_003641531.1.69983 WP_003641531.1.71240 WP_003641531.1.71366 WP_003641531.1.71807 WP_003641531.1.731 WP_003641531.1.73311 WP_003641531.1.73499 WP_003641531.1.74718 WP_003641531.1.74868 WP_003641531.1.76397 WP_003641531.1.76549 WP_003641531.1.76699 WP_003641531.1.76771 WP_003641531.1.7682 WP_003641531.1.76822 WP_003641531.1.77336 WP_003641531.1.77712 WP_003641531.1.77972 WP_003641531.1.78144 WP_003641531.1.8010 WP_003641531.1.80520 WP_003641531.1.80904 WP_003641531.1.81615 WP_003641531.1.82268 WP_003641531.1.82388 WP_003641531.1.82602 WP_003641531.1.82735 WP_003641531.1.83366 WP_003641531.1.83620 WP_003641531.1.83647 WP_003641531.1.83777 WP_003641531.1.84028 WP_003641531.1.84419 WP_003641531.1.85206 WP_003641531.1.85836 WP_003641531.1.86479 WP_003641531.1.88099 WP_003641531.1.89420 WP_003641531.1.89637 WP_003641531.1.90117 WP_003641531.1.90208 WP_003641531.1.90426 WP_003641531.1.91137 WP_003641531.1.91351 WP_003641531.1.9149 WP_003641531.1.91683 WP_003641531.1.92629 WP_003641531.1.92717 WP_003641531.1.93143 WP_003641531.1.93409 WP_003641531.1.93688 WP_003641531.1.94382 WP_003641531.1.94656 WP_003641531.1.94667 WP_003641531.1.95302 WP_003641531.1.95345 WP_003641531.1.95554 WP_003641531.1.9589 WP_003641531.1.96602 WP_003641531.1.96838 WP_003641531.1.9731 WP_003641531.1.97443 WP_003641531.1.98190 WP_003641531.1.9834 WP_003641531.1.98401 WP_003641531.1.99274 WP_003641531.1.99945 YP_004889989.1.96219 gi|448821774|ref|YP_007414936.1| gi|308181061|ref|YP_003925189.1| gi|254557067|ref|YP_003063484.1| gi|380032998|ref|YP_004889989.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]