SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_003647108.1.85201 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_003647108.1.85201
Domain Number 1 Region: 28-149
Classification Level Classification E-value
Superfamily Apolipoprotein 0.0000471
Family Apolipoprotein 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_003647108.1.85201
Sequence length 263
Comment cell division protein DivIVA [Lactobacillus gasseri]; AA=GCF_000176995.2; RF=na; TAX=575603; STAX=1596; NAME=Lactobacillus gasseri SJ-9E-US; strain=SJ-9E-US; AL=Scaffold; RT=Major
Sequence
MTLTPMDIHNKEFATKLRGYDSKQVDSFLDRIVDAYGDALDQIVDLKNENVELKKRVDKY
DKVKDSINESLISAQENAEEIKKKTNIEAQEIIKKANQDADDILKKAQDDGDKKRAELQS
QYDTLNHDYDLLKGKVEDFREAIQGMLKDQVKELSDSDWQYYLDKYYGRSRLYPADGSQP
VEDESIPDGPMDNEVAPQENVASANPEVDNNAVNEVNSVQEKEDKPGVLTGDSPVKESMH
ATEENTQRRNGPVIIFPDDLKNN
Download sequence
Identical sequences A0A087QDT6 A0A2I1RMX9
324831.LGAS_1197 WP_003647108.1.12732 WP_003647108.1.258 WP_003647108.1.27557 WP_003647108.1.30511 WP_003647108.1.4060 WP_003647108.1.42744 WP_003647108.1.53875 WP_003647108.1.60404 WP_003647108.1.85201 gi|116629832|ref|YP_815004.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]