SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_003651333.1.78621 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_003651333.1.78621
Domain Number 1 Region: 39-272
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 5.24e-64
Family Phosphate binding protein-like 0.0000755
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_003651333.1.78621
Sequence length 277
Comment methionine transporter [Acinetobacter calcoaceticus]; AA=GCF_000162035.1; RF=na; TAX=575585; STAX=471; NAME=Acinetobacter calcoaceticus RUH2202; strain=RUH2202; AL=Scaffold; RT=Major
Sequence
MAIQFKQYKPWLLGITILIVILGLVGYRYIKNKQTDDVLTIGISPPYAELLQSVANEVEK
QGVHVKLVEFSDWRAPNVAVQNGDIDANFFQQSVFLRNAVKETGYDLHAFAVGSGSHVGL
YSKKYKTLDDLPSQARVAIPNDPVNLARALILLHRAGLIQLKDSNNELSTTQDIIANPKQ
LSFVEVEGPQTAHAYNDVDLIFGFPHYLKMAKVTDPHSALFLDPIDKKYAILFVTRRDYQ
DKNQKLATFVKAFQNSKQAQDILDKDFGQGMWFQGWK
Download sequence
Identical sequences D0S396
WP_003651333.1.78621 HMPREF0012_00782T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]