SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_003699732.1.4481 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_003699732.1.4481
Domain Number 1 Region: 11-144
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.04e-27
Family MarR-like transcriptional regulators 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_003699732.1.4481
Sequence length 146
Comment MarR family transcriptional regulator [Lactobacillus salivarius]; AA=GCF_002159345.1; RF=na; TAX=1624; STAX=1624; NAME=Lactobacillus salivarius; strain=An63; AL=Contig; RT=Major
Sequence
MDERYQVINDALEKIYADIVWIEESELRKSVFSDITIKEMHAINAISMYDHQTASQVAKK
LHLTPGTLTATIDRLCRKGYAERIRGNDDRRIIRIGLTKKGRLVYRAHDAFHRMMVKSFL
KDLNPDEIKTIEKAIHNLEDFLKEHS
Download sequence
Identical sequences A0A0F7PWR3 A0A1D7TPA3 A0A2A7QQN6 A0A2A7RFS6 C2EEE3 F5VE70 F7QV76 H7FX91 Q1WUS5 V6DIV5
362948.LSL_0450 gi|90961427|ref|YP_535343.1| WP_003699732.1.11218 WP_003699732.1.14256 WP_003699732.1.15614 WP_003699732.1.17280 WP_003699732.1.18154 WP_003699732.1.18878 WP_003699732.1.24464 WP_003699732.1.2488 WP_003699732.1.25927 WP_003699732.1.26542 WP_003699732.1.27104 WP_003699732.1.34351 WP_003699732.1.38084 WP_003699732.1.42466 WP_003699732.1.4481 WP_003699732.1.48238 WP_003699732.1.48449 WP_003699732.1.50761 WP_003699732.1.54215 WP_003699732.1.54512 WP_003699732.1.59320 WP_003699732.1.61399 WP_003699732.1.62422 WP_003699732.1.62947 WP_003699732.1.63042 WP_003699732.1.63458 WP_003699732.1.6417 WP_003699732.1.65019 WP_003699732.1.65843 WP_003699732.1.672 WP_003699732.1.68358 WP_003699732.1.69932 WP_003699732.1.72086 WP_003699732.1.76244 WP_003699732.1.76636 WP_003699732.1.77078 WP_003699732.1.7912 WP_003699732.1.81444 WP_003699732.1.84698 WP_003699732.1.88204 WP_003699732.1.90376 WP_003699732.1.90868 WP_003699732.1.91721 WP_003699732.1.94487 WP_003699732.1.96920 WP_003699732.1.97660 WP_003699732.1.99703 YP_535343.1.8253

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]