SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_003790036.1.82230 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_003790036.1.82230
Domain Number 1 Region: 7-215
Classification Level Classification E-value
Superfamily CutC-like 1.29e-44
Family CutC-like 0.0000826
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_003790036.1.82230
Sequence length 229
Comment hypothetical protein [Actinomyces odontolyticus]; AA=GCF_000154225.1; RF=representative genome; TAX=411466; STAX=1660; NAME=Actinomyces odontolyticus ATCC 17982; strain=ATCC 17982; AL=Scaffold; RT=Major
Sequence
MAAVTTVEICVEDAVGVRRARDGGADRIEICTDLSCGGLTPAFDEVAAALEVAPAGGVQV
LVRPRPGDFVHTREEVDRIASDIMTLSSIGRGSDVRLGFVVGVITRDGQIDVNAAARLRD
TAEDAPLTFHRGFDQVADQDRGLDVLMELGYDRVLTTGGDPAVAQPDALARLVERGGDDI
IILVSGGLRAHNVAEVVAASGAREVHMRAPGTSGTDQAEVERIVAALHG
Download sequence
Identical sequences A7B8X8
WP_003790036.1.82230 ACTODO_00078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]