SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_003807623.1.43097 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_003807623.1.43097
Domain Number 1 Region: 99-161
Classification Level Classification E-value
Superfamily Sm-like ribonucleoproteins 0.0000000000000275
Family Mechanosensitive channel protein MscS (YggB), middle domain 0.0024
Further Details:      
 
Domain Number 2 Region: 16-98
Classification Level Classification E-value
Superfamily Mechanosensitive channel protein MscS (YggB), transmembrane region 0.000000000275
Family Mechanosensitive channel protein MscS (YggB), transmembrane region 0.0038
Further Details:      
 
Weak hits

Sequence:  WP_003807623.1.43097
Domain Number - Region: 171-232
Classification Level Classification E-value
Superfamily Mechanosensitive channel protein MscS (YggB), C-terminal domain 0.0536
Family Mechanosensitive channel protein MscS (YggB), C-terminal domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_003807623.1.43097
Sequence length 261
Comment transporter [Bifidobacterium adolescentis]; AA=GCF_001406215.1; RF=na; TAX=1680; STAX=1680; NAME=Bifidobacterium adolescentis; strain=2789STDY5834850; AL=Contig; RT=Major
Sequence
MDPVEILMHWLAKNYSKLILLAVVLIVAALIDKALTKVVRRMLDKSQVPNASIFVNILRV
VVWVFAIGTLLQPVFGINPTTLFTALGIGGLAVSLGLKDTIANVIGGFGLMLGRVIQPGD
YVKVAGITGTVKDINWRQTIVRERNGNEMVIPNSILNTASLEKLDPSNECLVSVPFTAKA
GVDVERMKADIVSTVEHATVGLANPQYKPVVKLNGFTPYGIDGTIYAFAKNDLLLSTMAD
AVAQSIAHADYLEHRAVGSGE
Download sequence
Identical sequences A0A174AKC0 A0ZZU0 A7A3L5
gi|119025210|ref|YP_909055.1| WP_003807623.1.36503 WP_003807623.1.43097 WP_003807623.1.47152 WP_003807623.1.51786 WP_003807623.1.5662 WP_003807623.1.64668 WP_003807623.1.81525 WP_003807623.1.95811 367928.BAD_0192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]