SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_003809860.1.41253 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_003809860.1.41253
Domain Number 1 Region: 100-382
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.58e-96
Family RecA protein-like (ATPase-domain) 0.0000000126
Further Details:      
 
Domain Number 2 Region: 384-511
Classification Level Classification E-value
Superfamily C-terminal domain of alpha and beta subunits of F1 ATP synthase 7.85e-42
Family C-terminal domain of alpha and beta subunits of F1 ATP synthase 0.0000401
Further Details:      
 
Domain Number 3 Region: 26-98
Classification Level Classification E-value
Superfamily N-terminal domain of alpha and beta subunits of F1 ATP synthase 1.2e-22
Family N-terminal domain of alpha and beta subunits of F1 ATP synthase 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_003809860.1.41253
Sequence length 542
Comment ATP synthase subunit alpha [Bifidobacterium adolescentis]; AA=GCF_002108095.1; RF=na; TAX=1680; STAX=1680; NAME=Bifidobacterium adolescentis; strain=AL46-7; AL=Contig; RT=Major
Sequence
MAELTIDPTTIRKALDEFVESYKPSDTPTQEVGYVATAGDGIAHVTGLPGCMANELLTFE
DGTLGLAFNLDAREIGVVILGDFTGIEEGQEVRRTGEVLSVPVGDGYLGRVVDPLGNPID
GLGEIKTEGRRILEAQAPDVMHRHPVDEPLSTGLKAIDAMTPIGRGQRQLIIGDRQTGKT
AIAIDTIINQKRNWESGDPKKQVRCIYVAVGQKGSTIASVKQSLEEAGAMEYTTIVASPA
SDSAGFKYIAPYTGSAIGQHWMYNGKHVLIVFDDLSKQAEAYRSISLLLRRPPGREAYPG
DVFYLHSRLLERCAKVSDDLGGGSMTGLPIVETKANDVSAYIPTNVISITDGQIFLQSDL
FNANQRPAVDVGISVSRVGGAAQTKALKKVSGTLKISLAQYRSLESFAMFASDLDAASKA
QLNRGAHLTELLKQPQFSPYSMEQEVVSVWAGTHGKMDDLPISDVLPFEKGMLDYLDHNT
DILKTIRETEDFTADTEAALDKAVEAFRETFVTSAGKPLVEKKPDEKHTTPVEQEKIVAG
EK
Download sequence
Identical sequences A0A087DHK9 A0A0C2YP95 A1A3C7 A7A6W9
gi|119026447|ref|YP_910292.1| 367928.BAD_1429 WP_003809860.1.16084 WP_003809860.1.23347 WP_003809860.1.24652 WP_003809860.1.31393 WP_003809860.1.3372 WP_003809860.1.36503 WP_003809860.1.38945 WP_003809860.1.41253 WP_003809860.1.43097 WP_003809860.1.47152 WP_003809860.1.51786 WP_003809860.1.55335 WP_003809860.1.55963 WP_003809860.1.5662 WP_003809860.1.6218 WP_003809860.1.64668 WP_003809860.1.68247 WP_003809860.1.74636 WP_003809860.1.76728 WP_003809860.1.81525 WP_003809860.1.90122 WP_003809860.1.92700 WP_003809860.1.95811

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]