SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_003810962.1.47152 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_003810962.1.47152
Domain Number 1 Region: 31-86
Classification Level Classification E-value
Superfamily YefM-like 0.0000000419
Family YefM-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_003810962.1.47152
Sequence length 112
Comment MULTISPECIES: prevent-host-death family protein [Bifidobacterium]; AA=GCF_000154085.1; RF=na; TAX=411481; STAX=1680; NAME=Bifidobacterium adolescentis L2-32; strain=L2-32; AL=Scaffold; RT=Major
Sequence
MRFQISQRRNMSAASILDSMVSVTSLNHGGASKALSQVGDNHPVVVLKNNQPSAVIITPA
DYRRLTQAEENFALYRKAVERLRNDDSTLLTDADVFGEDYEPIDDGFEPEFE
Download sequence
Identical sequences A0A1E7Y1H3 A1A2M2 A7A8X0
WP_003810962.1.23347 WP_003810962.1.31140 WP_003810962.1.36503 WP_003810962.1.47152 WP_003810962.1.49252 WP_003810962.1.64668 WP_003810962.1.88872 367928.BAD_1174 392726 gi|119026192|ref|YP_910037.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]