SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_003811443.1.82663 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_003811443.1.82663
Domain Number 1 Region: 81-266
Classification Level Classification E-value
Superfamily ClpP/crotonase 3.23e-25
Family Clp protease, ClpP subunit 0.047
Further Details:      
 
Domain Number 2 Region: 438-502
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000000000262
Family NfeD domain-like 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_003811443.1.82663
Sequence length 513
Comment serine protease [Bordetella bronchiseptica]; AA=GCF_000195675.1; RF=na; TAX=257310; STAX=518; NAME=Bordetella bronchiseptica RB50; strain=RB50; AL=Complete Genome; RT=Major
Sequence
MKRNYARKRSTLDPTRRARRPPSSAHRDLGDTRMHARVPRLVADLLHLLRLLGCLAALLL
PAAWDGARAADSAAPAPRTAVVLSLDGIVGPASADYVARGLAGAAAQHALVVLRIDTPGG
LDASMREIIRAILASPVPVLAYVAPGGARAASAGTYILYASHVAAMAPATNLGAATPVSL
GGGFTPSDDKTEPDKTDAKAPADGGKPATPRNAAEYKAINDAVAYIRALADLRGRNADWA
EQAVREAASLSASQALARNVIDIVAEDTPALLAQADGRTVRVGAANVVLHTSGLALVERG
PDWRTRLLGVITNPNLALILLMVGVYGLIFEFMSPGALFPGVLGAICLLLGLYALSVLPL
SYAGAGLVALGAALMVAEIFTPSLGALGVGGALSFVLGATMLVDADTPAYAVSLPLVGGV
AVASLGLTFLIARLALRSRRAPQVSGAQGLVGRRGRVLSWEHDQGYVAADGERWRARGPA
GLAAGDAVTIHAVQGVTLHVAPEPPAPQAPSRP
Download sequence
Identical sequences A0A0H3LN33
gi|33601768|ref|NP_889328.1| 257310.BB2792 WP_003811443.1.15674 WP_003811443.1.1660 WP_003811443.1.17334 WP_003811443.1.17359 WP_003811443.1.19828 WP_003811443.1.27032 WP_003811443.1.29688 WP_003811443.1.32589 WP_003811443.1.38534 WP_003811443.1.40806 WP_003811443.1.50287 WP_003811443.1.63717 WP_003811443.1.64622 WP_003811443.1.66177 WP_003811443.1.69310 WP_003811443.1.71104 WP_003811443.1.71382 WP_003811443.1.72041 WP_003811443.1.72302 WP_003811443.1.78117 WP_003811443.1.82663 WP_003811443.1.84976 WP_003811443.1.86585 WP_003811443.1.87218 WP_003811443.1.88542

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]