SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_003816182.1.2471 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_003816182.1.2471
Domain Number 1 Region: 72-149,194-255
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.0000000000000582
Family N-acetyl transferase, NAT 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_003816182.1.2471
Sequence length 288
Comment N-acetyltransferase [Bifidobacterium bifidum]; AA=GCF_001020325.1; RF=na; TAX=1681; STAX=1681; NAME=Bifidobacterium bifidum; strain=LMG 13200; AL=Contig; RT=Major
Sequence
MVAHDNTVMNATITNATPSADDESTLSESTPIGTDPQRDVMSDVVPDVTPEEVPGVTIAS
TPATATVPAEEMKPSQSVTYRPMRWNDLDDIVREFDRTWGQCSAAAGTPVSMQISRHFVL
HYLEPTTRAIIAELDGRFMGVTLSRVAGEPLAFPQAKQELAAINGELNRSTLGTKTLSET
EQWHEMELRMEREIDINDVARGEIELFLVAKSARGHGVGGSLWRQAMDYFANCQVARFYL
HTDSSCDVSFYDHKGLNCIAARYAADHPEDGADMDDIFIYAGTPENTR
Download sequence
Identical sequences A0A292G2X9 E3ELW3 K2HX08
gi|310286975|ref|YP_003938233.1| WP_003816182.1.2471 WP_003816182.1.26466 WP_003816182.1.44436 WP_003816182.1.55739 WP_003816182.1.84149

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]