SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_003875324.1.64277 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_003875324.1.64277
Domain Number 1 Region: 35-141
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.88e-17
Family Anti-sigma factor antagonist SpoIIaa 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_003875324.1.64277
Sequence length 145
Comment MULTISPECIES: anti-anti-sigma factor [Mycobacterium avium complex (MAC)]; AA=GCF_002089155.1; RF=na; TAX=439334; STAX=1764; NAME=Mycobacterium avium subsp. hominissuis; strain=DH-5; AL=Contig; RT=Major
Sequence
MNSVIVEPMSATHLTLSTKLVYELGDPNSTLRATTARSGSAVLIYAGGEIDACNEDTWRH
LVSEAAGVVTTPGPFVVDVTGLEFMGCCAFAVLTDEAKRCRQRGIDLRLVSCEPIVGRII
DACGLSDILPIYPTVDSALSGADRW
Download sequence
Identical sequences A0A1X0C844 A0A200GRW0 A0A2A2ZG75 A0A2A3LDZ9 Q73WB8 V7JAR9 V7KPK4 V7KU81 V7L9M0 V7LJI2 V7NBR3 V7P610
gi|41408840|ref|NP_961676.1| MypaA.17065.a WP_003875324.1.10000 WP_003875324.1.100504 WP_003875324.1.101064 WP_003875324.1.101159 WP_003875324.1.12505 WP_003875324.1.12954 WP_003875324.1.1369 WP_003875324.1.14373 WP_003875324.1.14707 WP_003875324.1.1472 WP_003875324.1.14816 WP_003875324.1.15384 WP_003875324.1.15663 WP_003875324.1.1614 WP_003875324.1.16293 WP_003875324.1.16945 WP_003875324.1.17266 WP_003875324.1.17624 WP_003875324.1.17884 WP_003875324.1.17915 WP_003875324.1.18785 WP_003875324.1.1994 WP_003875324.1.20882 WP_003875324.1.21011 WP_003875324.1.22949 WP_003875324.1.26008 WP_003875324.1.27804 WP_003875324.1.28864 WP_003875324.1.29527 WP_003875324.1.32203 WP_003875324.1.33234 WP_003875324.1.3468 WP_003875324.1.35500 WP_003875324.1.35510 WP_003875324.1.35606 WP_003875324.1.37369 WP_003875324.1.37642 WP_003875324.1.39409 WP_003875324.1.40837 WP_003875324.1.4542 WP_003875324.1.45459 WP_003875324.1.45501 WP_003875324.1.47364 WP_003875324.1.4754 WP_003875324.1.49379 WP_003875324.1.50439 WP_003875324.1.53280 WP_003875324.1.54538 WP_003875324.1.55522 WP_003875324.1.56146 WP_003875324.1.56366 WP_003875324.1.56924 WP_003875324.1.58557 WP_003875324.1.59206 WP_003875324.1.59922 WP_003875324.1.61195 WP_003875324.1.62113 WP_003875324.1.64277 WP_003875324.1.646 WP_003875324.1.64833 WP_003875324.1.66027 WP_003875324.1.66905 WP_003875324.1.67083 WP_003875324.1.67285 WP_003875324.1.6888 WP_003875324.1.69393 WP_003875324.1.7097 WP_003875324.1.71252 WP_003875324.1.72172 WP_003875324.1.74476 WP_003875324.1.74562 WP_003875324.1.7463 WP_003875324.1.74957 WP_003875324.1.75695 WP_003875324.1.75798 WP_003875324.1.76287 WP_003875324.1.78145 WP_003875324.1.78536 WP_003875324.1.7926 WP_003875324.1.80920 WP_003875324.1.81101 WP_003875324.1.81559 WP_003875324.1.8174 WP_003875324.1.82097 WP_003875324.1.82175 WP_003875324.1.82859 WP_003875324.1.83216 WP_003875324.1.83808 WP_003875324.1.84212 WP_003875324.1.87305 WP_003875324.1.87736 WP_003875324.1.88396 WP_003875324.1.88567 WP_003875324.1.89157 WP_003875324.1.92407 WP_003875324.1.9350 WP_003875324.1.93735 WP_003875324.1.93753 WP_003875324.1.96060 WP_003875324.1.98724 WP_003875324.1.98852 WP_003875324.1.98895 WP_003875324.1.99050 WP_003875324.1.9971 gi|499075450|ref|YP_007970928.1| 262316.MAP2742

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]