SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_003945457.1.40047 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_003945457.1.40047
Domain Number - Region: 20-86
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0144
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_003945457.1.40047
Sequence length 90
Comment MULTISPECIES: hypothetical protein [Rhodococcus]; AA=GCF_002091935.1; RF=na; TAX=1903183; STAX=1903183; NAME=Rhodococcus sp. 1159; strain=1159; AL=Scaffold; RT=Major
Sequence
MCRNITELRGLEPAATPEEIEAASRQYVRKVSGIAKVSDANRDAFEQAVREVTETTTRLL
SALPPRRQPPQTVPPLRRPEVQARIAARSS
Download sequence
Identical sequences A0A069JJ02 A0A0U3IR72 A0A1C4FXQ3 A0A1F2PWV9 C0ZQD0 C3JV12 T5I8F7 U0EDQ9
gi|532362995|ref|YP_008451394.1| gi|226304389|ref|YP_002764347.1| WP_003945457.1.101405 WP_003945457.1.17328 WP_003945457.1.26240 WP_003945457.1.2937 WP_003945457.1.3260 WP_003945457.1.3298 WP_003945457.1.3447 WP_003945457.1.37275 WP_003945457.1.38104 WP_003945457.1.38653 WP_003945457.1.40047 WP_003945457.1.428 WP_003945457.1.48667 WP_003945457.1.51229 WP_003945457.1.55320 WP_003945457.1.57831 WP_003945457.1.58082 WP_003945457.1.58299 WP_003945457.1.60401 WP_003945457.1.61677 WP_003945457.1.66626 WP_003945457.1.69155 WP_003945457.1.69306 WP_003945457.1.77150 WP_003945457.1.78616 WP_003945457.1.79292 WP_003945457.1.81178 WP_003945457.1.82590 WP_003945457.1.83724 WP_003945457.1.85181 WP_003945457.1.85987 WP_003945457.1.88476 WP_003945457.1.88663 WP_003945457.1.92716 WP_003945457.1.95272 WP_003945457.1.98030 234621.RER_09000

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]