SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_003974935.1.58943 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_003974935.1.58943
Domain Number 1 Region: 17-119
Classification Level Classification E-value
Superfamily SpoIIaa-like 6.67e-16
Family Anti-sigma factor antagonist SpoIIaa 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_003974935.1.58943
Sequence length 126
Comment MULTISPECIES: STAS domain-containing protein [Streptomyces]; AA=GCF_900104935.1; RF=na; TAX=1881022; STAX=1881022; NAME=Streptomyces sp. 2114.2; strain=2114.2; AL=Chromosome; RT=Major
Sequence
MTFRPQPWEPCEPCDPPGCAVLAMPSEIDFCNASGLLPLITTAVQQRSDGLRLLVLDLSG
TRFMDSQGVRLIAAVRCRLPGGTLLRVVAAPKSVPSRVLELSGLRRDVPVHDNVAEALRA
ESGTAA
Download sequence
Identical sequences D6EL86 Q9ADN1
100226.SCO4027 gi|21222430|ref|NP_628209.1| APC41004.0 NP_628209.1.49638 WP_003974935.1.26049 WP_003974935.1.30910 WP_003974935.1.43399 WP_003974935.1.55229 WP_003974935.1.58943 WP_003974935.1.86682

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]