SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_004025782.1.78419 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_004025782.1.78419
Domain Number 1 Region: 1-119
Classification Level Classification E-value
Superfamily Ribosomal protein L20 6.54e-43
Family Ribosomal protein L20 0.0000306
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_004025782.1.78419
Sequence length 120
Comment MULTISPECIES: 50S ribosomal protein L20 [Ureaplasma]; AA=GCF_000169935.1; RF=na; TAX=526347; STAX=2130; NAME=Ureaplasma urealyticum serovar 11 str. ATCC 33695; strain=ATCC 33695; AL=Contig; RT=Major
Sequence
MRVKGGSVTRQRRKRWLEKAEGSWGTRNTSYRIARQTVIRAAEYAYRDRRNKKRDFRKLW
ISRINAAVRELGYTYSQFMNALVKANVVTKDGQGLNRKMLSELAINNPEAFNQLVNKVMK
Download sequence
Identical sequences B1RY43 B2D9M7 B2NEJ6 B2NGM9 B3XT20 B3XUP4 B5BMV9 B5ZB38 B9ZXQ5 C0AFG7
565575.UUR10_0224 gi|209554474|ref|YP_002284628.1| WP_004025782.1.11034 WP_004025782.1.11042 WP_004025782.1.11293 WP_004025782.1.14788 WP_004025782.1.27588 WP_004025782.1.47624 WP_004025782.1.47960 WP_004025782.1.48701 WP_004025782.1.53767 WP_004025782.1.54081 WP_004025782.1.55625 WP_004025782.1.78419 WP_004025782.1.92358 WP_004025782.1.95657 WP_004025782.1.96248

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]