SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_004196764.1.53506 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_004196764.1.53506
Domain Number 1 Region: 1-106
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 2.27e-31
Family Frataxin-like 0.0000953
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_004196764.1.53506
Sequence length 108
Comment MULTISPECIES: iron donor protein CyaY [pseudomallei group]; AA=GCF_000757175.1; RF=na; TAX=28450; STAX=28450; NAME=Burkholderia pseudomallei; strain=BGQ; AL=Scaffold; RT=Major
Sequence
MSDTDYLTRAEAVLAAVERSVDAANDGDADIDLERNGSVLTLTFENGSKIIVNLQPPMKE
VWIAAKAGGFHYRFVDGAWRDTRSGDEFFAALTGYATQQAGMPIAFSA
Download sequence
Identical sequences A0A069B5K0 A0A0E1S245 A0A0E1TW05 A0A0E1UH62 A0A0E1WA84 A0A0F6GDR4 A0A0H3HUM2 A0A290YCH2 A0A2K3ERB5 A0A2K3G1T6 A0A2K3H809 A0A2K3HSV7 A1V8C9 A2S7F1 A3MRS9 A3NED9 A3P073 A8EM69 B1HL54 C4AUS9 Q3JMV4 Q62GA2 Q63Q50
gi|126441351|ref|YP_001060710.1| gi|124385605|ref|YP_001027870.1| gi|403520427|ref|YP_006654561.1| WP_004196764.1.100104 WP_004196764.1.100195 WP_004196764.1.10047 WP_004196764.1.100583 WP_004196764.1.100720 WP_004196764.1.100727 WP_004196764.1.100825 WP_004196764.1.100900 WP_004196764.1.1010 WP_004196764.1.101060 WP_004196764.1.101307 WP_004196764.1.101381 WP_004196764.1.101559 WP_004196764.1.101588 WP_004196764.1.102051 WP_004196764.1.10269 WP_004196764.1.10290 WP_004196764.1.10359 WP_004196764.1.10553 WP_004196764.1.10633 WP_004196764.1.10746 WP_004196764.1.10907 WP_004196764.1.11046 WP_004196764.1.11072 WP_004196764.1.11160 WP_004196764.1.11268 WP_004196764.1.11404 WP_004196764.1.11747 WP_004196764.1.11825 WP_004196764.1.11893 WP_004196764.1.11996 WP_004196764.1.11998 WP_004196764.1.12731 WP_004196764.1.12793 WP_004196764.1.12856 WP_004196764.1.12860 WP_004196764.1.13198 WP_004196764.1.13309 WP_004196764.1.13504 WP_004196764.1.13520 WP_004196764.1.13597 WP_004196764.1.13603 WP_004196764.1.13639 WP_004196764.1.13925 WP_004196764.1.14356 WP_004196764.1.14539 WP_004196764.1.14557 WP_004196764.1.1465 WP_004196764.1.14660 WP_004196764.1.15170 WP_004196764.1.15364 WP_004196764.1.15525 WP_004196764.1.15673 WP_004196764.1.15696 WP_004196764.1.16090 WP_004196764.1.16113 WP_004196764.1.16249 WP_004196764.1.16358 WP_004196764.1.16540 WP_004196764.1.16561 WP_004196764.1.16625 WP_004196764.1.16680 WP_004196764.1.16689 WP_004196764.1.16749 WP_004196764.1.17067 WP_004196764.1.17068 WP_004196764.1.17278 WP_004196764.1.17473 WP_004196764.1.17748 WP_004196764.1.17786 WP_004196764.1.18396 WP_004196764.1.18405 WP_004196764.1.18471 WP_004196764.1.18549 WP_004196764.1.18631 WP_004196764.1.18669 WP_004196764.1.18704 WP_004196764.1.18744 WP_004196764.1.18868 WP_004196764.1.18906 WP_004196764.1.19401 WP_004196764.1.19486 WP_004196764.1.19540 WP_004196764.1.19629 WP_004196764.1.1976 WP_004196764.1.19815 WP_004196764.1.19842 WP_004196764.1.19854 WP_004196764.1.20021 WP_004196764.1.20246 WP_004196764.1.20501 WP_004196764.1.20520 WP_004196764.1.20531 WP_004196764.1.20673 WP_004196764.1.20954 WP_004196764.1.21147 WP_004196764.1.21205 WP_004196764.1.21291 WP_004196764.1.21304 WP_004196764.1.21409 WP_004196764.1.21442 WP_004196764.1.21461 WP_004196764.1.21653 WP_004196764.1.21809 WP_004196764.1.21907 WP_004196764.1.22046 WP_004196764.1.22308 WP_004196764.1.22329 WP_004196764.1.2261 WP_004196764.1.22625 WP_004196764.1.22779 WP_004196764.1.23009 WP_004196764.1.23086 WP_004196764.1.23104 WP_004196764.1.23131 WP_004196764.1.2317 WP_004196764.1.23385 WP_004196764.1.23743 WP_004196764.1.23852 WP_004196764.1.23994 WP_004196764.1.24020 WP_004196764.1.2404 WP_004196764.1.24314 WP_004196764.1.24372 WP_004196764.1.24454 WP_004196764.1.24513 WP_004196764.1.2462 WP_004196764.1.24701 WP_004196764.1.25068 WP_004196764.1.25102 WP_004196764.1.25138 WP_004196764.1.25265 WP_004196764.1.25412 WP_004196764.1.25628 WP_004196764.1.25728 WP_004196764.1.259 WP_004196764.1.26054 WP_004196764.1.26445 WP_004196764.1.26502 WP_004196764.1.26535 WP_004196764.1.26565 WP_004196764.1.26645 WP_004196764.1.267 WP_004196764.1.26838 WP_004196764.1.26849 WP_004196764.1.27064 WP_004196764.1.27069 WP_004196764.1.27146 WP_004196764.1.27363 WP_004196764.1.27390 WP_004196764.1.27399 WP_004196764.1.27420 WP_004196764.1.27441 WP_004196764.1.27597 WP_004196764.1.2767 WP_004196764.1.27810 WP_004196764.1.27909 WP_004196764.1.28018 WP_004196764.1.28066 WP_004196764.1.28187 WP_004196764.1.28453 WP_004196764.1.28594 WP_004196764.1.28619 WP_004196764.1.28632 WP_004196764.1.29148 WP_004196764.1.29161 WP_004196764.1.29178 WP_004196764.1.29335 WP_004196764.1.29405 WP_004196764.1.29508 WP_004196764.1.29520 WP_004196764.1.29547 WP_004196764.1.29658 WP_004196764.1.29853 WP_004196764.1.29878 WP_004196764.1.29887 WP_004196764.1.29899 WP_004196764.1.29948 WP_004196764.1.30311 WP_004196764.1.30382 WP_004196764.1.3041 WP_004196764.1.30671 WP_004196764.1.3069 WP_004196764.1.30729 WP_004196764.1.31723 WP_004196764.1.31831 WP_004196764.1.32174 WP_004196764.1.32182 WP_004196764.1.32221 WP_004196764.1.324 WP_004196764.1.3251 WP_004196764.1.32581 WP_004196764.1.3273 WP_004196764.1.32951 WP_004196764.1.33077 WP_004196764.1.33087 WP_004196764.1.33130 WP_004196764.1.33157 WP_004196764.1.33158 WP_004196764.1.33165 WP_004196764.1.332 WP_004196764.1.33366 WP_004196764.1.33419 WP_004196764.1.33493 WP_004196764.1.33543 WP_004196764.1.33573 WP_004196764.1.33779 WP_004196764.1.34230 WP_004196764.1.34333 WP_004196764.1.34393 WP_004196764.1.34564 WP_004196764.1.34747 WP_004196764.1.35025 WP_004196764.1.35052 WP_004196764.1.35090 WP_004196764.1.35141 WP_004196764.1.35227 WP_004196764.1.35249 WP_004196764.1.35474 WP_004196764.1.35485 WP_004196764.1.35491 WP_004196764.1.35757 WP_004196764.1.35825 WP_004196764.1.35878 WP_004196764.1.36106 WP_004196764.1.36174 WP_004196764.1.36259 WP_004196764.1.36527 WP_004196764.1.366 WP_004196764.1.36662 WP_004196764.1.36666 WP_004196764.1.36944 WP_004196764.1.37 WP_004196764.1.3706 WP_004196764.1.37373 WP_004196764.1.37428 WP_004196764.1.37446 WP_004196764.1.37517 WP_004196764.1.37519 WP_004196764.1.37535 WP_004196764.1.37581 WP_004196764.1.37622 WP_004196764.1.37627 WP_004196764.1.37690 WP_004196764.1.37702 WP_004196764.1.37725 WP_004196764.1.37806 WP_004196764.1.37934 WP_004196764.1.37959 WP_004196764.1.37994 WP_004196764.1.38115 WP_004196764.1.38442 WP_004196764.1.38490 WP_004196764.1.38683 WP_004196764.1.3872 WP_004196764.1.38810 WP_004196764.1.38946 WP_004196764.1.39078 WP_004196764.1.39162 WP_004196764.1.39179 WP_004196764.1.39349 WP_004196764.1.39595 WP_004196764.1.39757 WP_004196764.1.39898 WP_004196764.1.40021 WP_004196764.1.40045 WP_004196764.1.40191 WP_004196764.1.40235 WP_004196764.1.40275 WP_004196764.1.40388 WP_004196764.1.40390 WP_004196764.1.40426 WP_004196764.1.40448 WP_004196764.1.4077 WP_004196764.1.41477 WP_004196764.1.41588 WP_004196764.1.41945 WP_004196764.1.42408 WP_004196764.1.42492 WP_004196764.1.42496 WP_004196764.1.42800 WP_004196764.1.43136 WP_004196764.1.43156 WP_004196764.1.43373 WP_004196764.1.43542 WP_004196764.1.43581 WP_004196764.1.43587 WP_004196764.1.43678 WP_004196764.1.43727 WP_004196764.1.43786 WP_004196764.1.43899 WP_004196764.1.44179 WP_004196764.1.44234 WP_004196764.1.44352 WP_004196764.1.44414 WP_004196764.1.44540 WP_004196764.1.44824 WP_004196764.1.45284 WP_004196764.1.45348 WP_004196764.1.45356 WP_004196764.1.45537 WP_004196764.1.45715 WP_004196764.1.45890 WP_004196764.1.4631 WP_004196764.1.46575 WP_004196764.1.46757 WP_004196764.1.46829 WP_004196764.1.4693 WP_004196764.1.46969 WP_004196764.1.47086 WP_004196764.1.47149 WP_004196764.1.4718 WP_004196764.1.47564 WP_004196764.1.48093 WP_004196764.1.4810 WP_004196764.1.48165 WP_004196764.1.48313 WP_004196764.1.48407 WP_004196764.1.48464 WP_004196764.1.49026 WP_004196764.1.49717 WP_004196764.1.49872 WP_004196764.1.50174 WP_004196764.1.50320 WP_004196764.1.50336 WP_004196764.1.50401 WP_004196764.1.50636 WP_004196764.1.50788 WP_004196764.1.50839 WP_004196764.1.5105 WP_004196764.1.51606 WP_004196764.1.51666 WP_004196764.1.5173 WP_004196764.1.5182 WP_004196764.1.51874 WP_004196764.1.51891 WP_004196764.1.51902 WP_004196764.1.52229 WP_004196764.1.52365 WP_004196764.1.52407 WP_004196764.1.52521 WP_004196764.1.52547 WP_004196764.1.52643 WP_004196764.1.52655 WP_004196764.1.52731 WP_004196764.1.52760 WP_004196764.1.52882 WP_004196764.1.5292 WP_004196764.1.53034 WP_004196764.1.53048 WP_004196764.1.53103 WP_004196764.1.53132 WP_004196764.1.53282 WP_004196764.1.5338 WP_004196764.1.53386 WP_004196764.1.53506 WP_004196764.1.53578 WP_004196764.1.53977 WP_004196764.1.54016 WP_004196764.1.5413 WP_004196764.1.54312 WP_004196764.1.54369 WP_004196764.1.54804 WP_004196764.1.54859 WP_004196764.1.54892 WP_004196764.1.55038 WP_004196764.1.55415 WP_004196764.1.55691 WP_004196764.1.55755 WP_004196764.1.55974 WP_004196764.1.55996 WP_004196764.1.5608 WP_004196764.1.56126 WP_004196764.1.56248 WP_004196764.1.5641 WP_004196764.1.56451 WP_004196764.1.56458 WP_004196764.1.56591 WP_004196764.1.56744 WP_004196764.1.56949 WP_004196764.1.56993 WP_004196764.1.57046 WP_004196764.1.57096 WP_004196764.1.57247 WP_004196764.1.5734 WP_004196764.1.57341 WP_004196764.1.57359 WP_004196764.1.57679 WP_004196764.1.5776 WP_004196764.1.58003 WP_004196764.1.58105 WP_004196764.1.58190 WP_004196764.1.58355 WP_004196764.1.58362 WP_004196764.1.58405 WP_004196764.1.58509 WP_004196764.1.58523 WP_004196764.1.58578 WP_004196764.1.58639 WP_004196764.1.58758 WP_004196764.1.5883 WP_004196764.1.59103 WP_004196764.1.59200 WP_004196764.1.59422 WP_004196764.1.59496 WP_004196764.1.59519 WP_004196764.1.59536 WP_004196764.1.59549 WP_004196764.1.59747 WP_004196764.1.60398 WP_004196764.1.60769 WP_004196764.1.60810 WP_004196764.1.60833 WP_004196764.1.60836 WP_004196764.1.60969 WP_004196764.1.61073 WP_004196764.1.61084 WP_004196764.1.61202 WP_004196764.1.61455 WP_004196764.1.61588 WP_004196764.1.61685 WP_004196764.1.61723 WP_004196764.1.61854 WP_004196764.1.6186 WP_004196764.1.61900 WP_004196764.1.62103 WP_004196764.1.62183 WP_004196764.1.62774 WP_004196764.1.63097 WP_004196764.1.63261 WP_004196764.1.63361 WP_004196764.1.63439 WP_004196764.1.63505 WP_004196764.1.63661 WP_004196764.1.63719 WP_004196764.1.63942 WP_004196764.1.64068 WP_004196764.1.64096 WP_004196764.1.64166 WP_004196764.1.64204 WP_004196764.1.64364 WP_004196764.1.64383 WP_004196764.1.64542 WP_004196764.1.64683 WP_004196764.1.64892 WP_004196764.1.65093 WP_004196764.1.65270 WP_004196764.1.65468 WP_004196764.1.65832 WP_004196764.1.65994 WP_004196764.1.66257 WP_004196764.1.66321 WP_004196764.1.66380 WP_004196764.1.66594 WP_004196764.1.67013 WP_004196764.1.67117 WP_004196764.1.67182 WP_004196764.1.67229 WP_004196764.1.67393 WP_004196764.1.67559 WP_004196764.1.6765 WP_004196764.1.67860 WP_004196764.1.67909 WP_004196764.1.67914 WP_004196764.1.67978 WP_004196764.1.6835 WP_004196764.1.68353 WP_004196764.1.68515 WP_004196764.1.68664 WP_004196764.1.68886 WP_004196764.1.68922 WP_004196764.1.69022 WP_004196764.1.69081 WP_004196764.1.69106 WP_004196764.1.69169 WP_004196764.1.69217 WP_004196764.1.69337 WP_004196764.1.69354 WP_004196764.1.69508 WP_004196764.1.69770 WP_004196764.1.69918 WP_004196764.1.70016 WP_004196764.1.7006 WP_004196764.1.70066 WP_004196764.1.70096 WP_004196764.1.70278 WP_004196764.1.70280 WP_004196764.1.70735 WP_004196764.1.71392 WP_004196764.1.71444 WP_004196764.1.71564 WP_004196764.1.71901 WP_004196764.1.72015 WP_004196764.1.72083 WP_004196764.1.72545 WP_004196764.1.72798 WP_004196764.1.72817 WP_004196764.1.73317 WP_004196764.1.73418 WP_004196764.1.73521 WP_004196764.1.73576 WP_004196764.1.73906 WP_004196764.1.73974 WP_004196764.1.74177 WP_004196764.1.74425 WP_004196764.1.7450 WP_004196764.1.74569 WP_004196764.1.74675 WP_004196764.1.74690 WP_004196764.1.75001 WP_004196764.1.75027 WP_004196764.1.75075 WP_004196764.1.75230 WP_004196764.1.75276 WP_004196764.1.75519 WP_004196764.1.75677 WP_004196764.1.75708 WP_004196764.1.75711 WP_004196764.1.75776 WP_004196764.1.75861 WP_004196764.1.75883 WP_004196764.1.75913 WP_004196764.1.75937 WP_004196764.1.76142 WP_004196764.1.76290 WP_004196764.1.76432 WP_004196764.1.76522 WP_004196764.1.76575 WP_004196764.1.766 WP_004196764.1.7703 WP_004196764.1.77249 WP_004196764.1.77287 WP_004196764.1.77319 WP_004196764.1.77689 WP_004196764.1.77788 WP_004196764.1.77845 WP_004196764.1.78029 WP_004196764.1.78278 WP_004196764.1.78506 WP_004196764.1.78557 WP_004196764.1.78628 WP_004196764.1.78759 WP_004196764.1.78807 WP_004196764.1.78827 WP_004196764.1.79052 WP_004196764.1.79360 WP_004196764.1.795 WP_004196764.1.79653 WP_004196764.1.79689 WP_004196764.1.79710 WP_004196764.1.79725 WP_004196764.1.79782 WP_004196764.1.80098 WP_004196764.1.80302 WP_004196764.1.80395 WP_004196764.1.80433 WP_004196764.1.80614 WP_004196764.1.80923 WP_004196764.1.81042 WP_004196764.1.8126 WP_004196764.1.81479 WP_004196764.1.81511 WP_004196764.1.81543 WP_004196764.1.81665 WP_004196764.1.82197 WP_004196764.1.82283 WP_004196764.1.82323 WP_004196764.1.82394 WP_004196764.1.82506 WP_004196764.1.82575 WP_004196764.1.82694 WP_004196764.1.82727 WP_004196764.1.82915 WP_004196764.1.82950 WP_004196764.1.83080 WP_004196764.1.83357 WP_004196764.1.8341 WP_004196764.1.83487 WP_004196764.1.83543 WP_004196764.1.83567 WP_004196764.1.83609 WP_004196764.1.83688 WP_004196764.1.8388 WP_004196764.1.8390 WP_004196764.1.8395 WP_004196764.1.84002 WP_004196764.1.84026 WP_004196764.1.84063 WP_004196764.1.84181 WP_004196764.1.84375 WP_004196764.1.84379 WP_004196764.1.84480 WP_004196764.1.84654 WP_004196764.1.84866 WP_004196764.1.85170 WP_004196764.1.85412 WP_004196764.1.85443 WP_004196764.1.85467 WP_004196764.1.85490 WP_004196764.1.85565 WP_004196764.1.85584 WP_004196764.1.856 WP_004196764.1.85641 WP_004196764.1.85774 WP_004196764.1.8585 WP_004196764.1.8629 WP_004196764.1.86295 WP_004196764.1.86438 WP_004196764.1.86525 WP_004196764.1.86806 WP_004196764.1.86872 WP_004196764.1.8697 WP_004196764.1.87114 WP_004196764.1.87278 WP_004196764.1.87324 WP_004196764.1.87553 WP_004196764.1.87652 WP_004196764.1.87759 WP_004196764.1.88003 WP_004196764.1.88117 WP_004196764.1.88168 WP_004196764.1.88237 WP_004196764.1.88322 WP_004196764.1.88369 WP_004196764.1.88411 WP_004196764.1.88666 WP_004196764.1.88682 WP_004196764.1.88764 WP_004196764.1.88920 WP_004196764.1.89093 WP_004196764.1.8912 WP_004196764.1.89240 WP_004196764.1.89435 WP_004196764.1.89514 WP_004196764.1.89782 WP_004196764.1.90079 WP_004196764.1.90471 WP_004196764.1.9079 WP_004196764.1.90934 WP_004196764.1.91025 WP_004196764.1.91142 WP_004196764.1.91700 WP_004196764.1.91709 WP_004196764.1.91763 WP_004196764.1.91823 WP_004196764.1.92095 WP_004196764.1.9236 WP_004196764.1.92367 WP_004196764.1.92406 WP_004196764.1.92430 WP_004196764.1.92493 WP_004196764.1.92507 WP_004196764.1.9280 WP_004196764.1.9281 WP_004196764.1.92904 WP_004196764.1.93844 WP_004196764.1.93845 WP_004196764.1.94023 WP_004196764.1.94050 WP_004196764.1.94117 WP_004196764.1.94121 WP_004196764.1.94286 WP_004196764.1.94403 WP_004196764.1.94498 WP_004196764.1.94520 WP_004196764.1.9479 WP_004196764.1.94901 WP_004196764.1.94926 WP_004196764.1.95054 WP_004196764.1.95300 WP_004196764.1.95339 WP_004196764.1.9537 WP_004196764.1.95420 WP_004196764.1.95587 WP_004196764.1.95644 WP_004196764.1.95672 WP_004196764.1.95938 WP_004196764.1.95952 WP_004196764.1.96381 WP_004196764.1.96660 WP_004196764.1.97058 WP_004196764.1.97112 WP_004196764.1.97148 WP_004196764.1.97989 WP_004196764.1.98066 WP_004196764.1.98218 WP_004196764.1.98316 WP_004196764.1.98491 WP_004196764.1.98547 WP_004196764.1.98688 WP_004196764.1.98713 WP_004196764.1.98753 WP_004196764.1.98768 WP_004196764.1.98944 WP_004196764.1.99061 WP_004196764.1.99069 WP_004196764.1.99160 WP_004196764.1.99233 WP_004196764.1.99290 WP_004196764.1.9962 WP_004196764.1.99629 WP_004196764.1.99741 WP_004196764.1.9975 WP_004196764.1.9983 WP_004196764.1.99890 WP_004196764.1.99919 YP_104272.1.87047 YP_109768.1.59693 gi|76809222|ref|YP_335099.1| gi|53720782|ref|YP_109768.1| gi|121600014|ref|YP_994482.1| gi|386863432|ref|YP_006276381.1| gi|556577460|ref|YP_008744280.1| gi|126455414|ref|YP_001067994.1| 243160.BMA2754 272560.BPSL3175 320372.BURPS1710b_3735 320373.BURPS668_3706 320388.BMASAVP1_A3199 320389.BMA10247_3449 357348.BURPS1106A_3764 412022.BMA10229_A1895 gi|53723886|ref|YP_104272.1| gi|526471105|ref|YP_008342362.1| gi|126449553|ref|YP_001082965.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]