SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_004198527.1.82283 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_004198527.1.82283
Domain Number 1 Region: 99-386
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.97e-74
Family D-glucarate dehydratase-like 0.00024
Further Details:      
 
Domain Number 2 Region: 1-112
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 4.42e-34
Family Enolase N-terminal domain-like 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_004198527.1.82283
Sequence length 402
Comment starvation sensing protein RspA [Burkholderia mallei]; AA=GCF_000565425.1; RF=na; TAX=1382516; STAX=13373; NAME=Burkholderia mallei 2000031281; strain=2000031281; AL=Contig; RT=Major
Sequence
MKIERLNIIVTCPGRNFVTVKIVTDEGVHGLGDATLNGRELAVRAYLEDHVFPCLIGRDP
RDIEDIWQYLYRGAYWRRGPVTMTAIAAIDMALWDIKSKLAGMPVYQLLGGKSREGLMVY
GHANGRDHDEAIDAAHRHIAAGYRAIRVQSGVPGLAKVYGVGKTAGAYEPAEKGLPPEEP
WDTALYLRHTPELFRKVRDALGDAPHLLHDAHHRLTPIEAARLGRDLEPYRLFWLEDATP
AENQDAFRLIRSHTTTTLAVGEVFNSIWDCKDLIRDQLIDYIRATIVHAGGITHVRRIAD
YAAMYQVRTGFHGATDLSPVCMAAAVNFGLWAPNFGIQELMPHTALTDEVFPHNYRFDDG
YLVMDDVPGLGVDIDETLAANYPYERAYLPVARLRDGSMWNW
Download sequence
Identical sequences A0A0H2WE46 A0A290YHN4 A2RXU0 C4B1G0
gi|53717402|ref|YP_105485.1| 243160.BMAA0766 320388.BMASAVP1_0583 320389.BMA10247_A1648 412022.BMA10229_0694 gi|124382521|ref|YP_001024509.1| gi|121597296|ref|YP_990192.1| gi|126447832|ref|YP_001078831.1| WP_004198527.1.100104 WP_004198527.1.20531 WP_004198527.1.22329 WP_004198527.1.23385 WP_004198527.1.26445 WP_004198527.1.28453 WP_004198527.1.29148 WP_004198527.1.31831 WP_004198527.1.33543 WP_004198527.1.34747 WP_004198527.1.35757 WP_004198527.1.35878 WP_004198527.1.38946 WP_004198527.1.40191 WP_004198527.1.43899 WP_004198527.1.44540 WP_004198527.1.4810 WP_004198527.1.48313 WP_004198527.1.53977 WP_004198527.1.54892 WP_004198527.1.57679 WP_004198527.1.67393 WP_004198527.1.69508 WP_004198527.1.72545 WP_004198527.1.74675 WP_004198527.1.75861 WP_004198527.1.78557 WP_004198527.1.79653 WP_004198527.1.82283 WP_004198527.1.84063 WP_004198527.1.84480 WP_004198527.1.9236 WP_004198527.1.9281 WP_004198527.1.95952 WP_004198527.1.96660 WP_004198527.1.98066 YP_105485.1.87047 NYSGXRC-9262g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]