SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_004215526.1.81346 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_004215526.1.81346
Domain Number 1 Region: 10-241
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 7.76e-24
Family Phosphate binding protein-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_004215526.1.81346
Sequence length 333
Comment myristoyl transferase [Natrialba magadii]; AA=GCF_000025625.1; RF=representative genome; TAX=547559; STAX=13769; NAME=Natrialba magadii ATCC 43099; strain=ATCC 43099; AL=Complete Genome; RT=Major
Sequence
MTNATVDFQLNWEPNGFQAPYFLARDRGFYEDEGLDVRFVEGHGSPFAAEQAAKGRAEFA
LAGASAVLSIQSRGLDPLAVAAVTGKTPAAIYTFRDEFGEALTDPDQLRGCTIAPSATKT
RILTAQLLEDEGISDEVDLLGVDDHTHHRVQHKLLDGRVDAAVGVVTNGYELEAEHDRQA
DELPIGDHLGVYGMMLVTSPEFASEEPETVRSFLRATARGWEAATTDPDAAIDVLVERNA
TLERNRPVEQRKFETAATDLQFTDRTRSEGWGLHDGERWQTLGQTLTETDLLEGEIDPDA
VWTNEFIDTEDDVIGNYAERVGESAETEAEPRT
Download sequence
Identical sequences D3SXG2
gi|289582007|ref|YP_003480473.1| WP_004215526.1.6702 WP_004215526.1.81346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]