SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_004217154.1.6702 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_004217154.1.6702
Domain Number 1 Region: 1-147
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.06e-31
Family GHMP Kinase, N-terminal domain 0.0000496
Further Details:      
 
Domain Number 2 Region: 155-291
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 1.2e-24
Family Homoserine kinase 0.00075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_004217154.1.6702
Sequence length 296
Comment homoserine kinase [Natrialba magadii]; AA=GCF_000337875.1; RF=na; TAX=547559; STAX=13769; NAME=Natrialba magadii ATCC 43099; strain=MS-3; AL=Contig; RT=Major
Sequence
MLTVRAPATSANLGSGFDVFGVALGAPADIVRVSRAPETTITVTGTGSEYIPEDPKKNTV
GAVAEALDAPAHIEIDKGVRPSSGLGSSAASAAGAAVALNELYDRGLSRKELVPIAAEGE
AIVSGTAHADNVAPSLLGGFVIVTDDGITQVDASLPVVVCLPEITVSTCDARGVVPEQAR
LGDVVDTVGHAATLSVGMTRNDPELVGRGMADEIVTPERSVLIDGYDAVREAALESGATG
VTVSGAGPAILAVCRTESDRGAVAGAMLDAFDAVGIESRAYQTAIGEGAHVYGDRS
Download sequence
Identical sequences D3SSA7
WP_004217154.1.6702 WP_004217154.1.81346 gi|289580929|ref|YP_003479395.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]