SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_004218117.1.94304 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_004218117.1.94304
Domain Number 1 Region: 911-1021
Classification Level Classification E-value
Superfamily TPR-like 0.0000557
Family Tetratricopeptide repeat (TPR) 0.039
Further Details:      
 
Weak hits

Sequence:  WP_004218117.1.94304
Domain Number - Region: 16-35
Classification Level Classification E-value
Superfamily B12-dependent dehydatase associated subunit 0.0628
Family Diol dehydratase, beta subunit 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_004218117.1.94304
Sequence length 1109
Comment hypothetical protein [Bifidobacterium animalis]; AA=GCF_000092765.1; RF=na; TAX=573236; STAX=28025; NAME=Bifidobacterium animalis subsp. lactis V9; strain=V9; AL=Complete Genome; RT=Major
Sequence
MTGTNSNTSDPQPRKPARWLRNLGVNAARYARQVESTAQSMFAGALPTHNMFTPTPTNPL
LGVKMPSAETIVLNPLMRRRSFSVAGTGLPFERVGWVQMPGLRRFALGYFTSHDRFCTLA
MADDTGAVYMTGDLYANLDAREPDLELDVTDSLTTDDDSRFGGTKPAHIATVEGSARALV
GDIRGRDGNGRMVWLARFLKSANRYTIENARAELPARLRTDLEYRDLMAVCFFHLYLAVS
VNGGLQGYGAGNIISNFRRFSPLAAIRTSVSQTDTARAHRMRVSGLEEYFADTMRRIGVM
GDLSELEADHGSEPLYMIESPVSHARFLVWEKRMPYDAMLTSLKLEGAVNRFLLIDKWLD
YNAAHSEQPIEDTVTFKQVARIDRRLLRNPSLSALPPTHPVHILDDPECFRVDDYLHFGR
GMSLSASLDASQAGVGVDVRHLVGSEWIYRHALANAVNALWLPFRFDTDFRSNLQQGEVA
FAFTSASRTLMPDELINMRSGAMAELDEAERSRISAEYNLQIGLIFASLAFGASEQIRRV
SLRMDSLGLEEAVYERDNAIKTLMDSAMTQISDLTNLEDFTTHAGQGRFGERGSALFSGS
EETSGVGDDEHDGVQTQAMQTDADFDRELRDLLEHDESTSSDDTTTHHAESEDDTVQSIL
NVDEEFDRLRNSNPSIKHLLTVTFTRDEFIDYMHANSCADPFAVYDAFGAQYDYDGTEGF
RPVEPGFSMDDTRFTGDAAYTIPERRDRPLDATVARSLGAHNVRDLSISREEMFRGTLEL
IADTAKNDGLRADRKATYAMGLIEQCADPELRNHATEITTAIIDGTPIPQITSTVERALA
DARRKSQEMVFSGDEEGAIANMERVIGELDEMFESDGVVPRYFTSYTDRVVYNRLFAMPD
ERIALVPDALFQAHLDMGEVLFRYDRGEEAMAHLNTLVRYAPATAGVHIQQAIRLCVSED
WNSVRAAALNALRVACDPVDAANAYYYYVCASWMKGDTAVAVAAGNLATSLTQNLAPAQR
ARLERFRNLAMAQGEQIAQTGAQAVGVLMRHDVPVWPQVECAQIIRDAAFTATNEKIFPV
AQALNVSWYALQGGNLGPGGMQFLRSLNA
Download sequence
Identical sequences A0A2G9ISD5 B8DU31
gi|241190735|ref|YP_002968129.1| gi|384195293|ref|YP_005581038.1| 442563.BLA_1222 555970.Balat_0694 580050.Balac_0694 gi|387820604|ref|YP_006300647.1| gi|219683703|ref|YP_002470086.1| gi|518657120|ref|YP_008143482.1| gi|241196141|ref|YP_002969696.1| gi|384193732|ref|YP_005579478.1| WP_004218117.1.14456 WP_004218117.1.20477 WP_004218117.1.22654 WP_004218117.1.23267 WP_004218117.1.23846 WP_004218117.1.23969 WP_004218117.1.26294 WP_004218117.1.34099 WP_004218117.1.38287 WP_004218117.1.38998 WP_004218117.1.45260 WP_004218117.1.45775 WP_004218117.1.47471 WP_004218117.1.47549 WP_004218117.1.50484 WP_004218117.1.53490 WP_004218117.1.62237 WP_004218117.1.66072 WP_004218117.1.75174 WP_004218117.1.78909 WP_004218117.1.86686 WP_004218117.1.86797 WP_004218117.1.94304 gi|387822280|ref|YP_006302229.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]