SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_004268418.1.45260 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_004268418.1.45260
Domain Number 1 Region: 25-212,323-405
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.88e-38
Family Bacterial dinuclear zinc exopeptidases 0.014
Further Details:      
 
Domain Number 2 Region: 200-295
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 5.68e-19
Family Bacterial exopeptidase dimerisation domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_004268418.1.45260
Sequence length 406
Comment succinyl-diaminopimelate desuccinylase [Bifidobacterium animalis]; AA=GCF_000695895.1; RF=na; TAX=28025; STAX=28025; NAME=Bifidobacterium animalis; strain=RH; AL=Complete Genome; RT=Major
Sequence
MQDVIDRAGEPLKLTVDAGVGEQAALTDLCMQVMRVYSVSDDETHLTDMTEAFLRTLPHL
DVQRHGDTLVARTNLGRDRRVVLAGHLDVVPVIDNFPPKLLEPGDPLILPGVAEAHPGER
VVWGRGATDMKSSDAVLLYLAATLTNPKYDLTYVFYDHEEVAAEKNGLRKVAEAHPDWIA
GDFAIIGEPTSCGIEGGCNGTIRFDVVTHGIAAHSARAWMGHNAIHDAAEILRRLNEHTD
ATVSVDGLVYREGLNATLISGGKGTNVIPDECRVHVNYRFAPDKSLAEAKALMMGADCGA
ELGNGEHQATGGVFEGFGIEMKDESPSARPGMDSELTRSLAALAKARTGKDPEAKLGWTD
VARFSQLGVPAVNFGAGSPLLAHKHDEQVAEGELTLMAGILRDWLS
Download sequence
Identical sequences A0A2G9IRX5
WP_004268418.1.14456 WP_004268418.1.16162 WP_004268418.1.20477 WP_004268418.1.21588 WP_004268418.1.22654 WP_004268418.1.23267 WP_004268418.1.23846 WP_004268418.1.23969 WP_004268418.1.26294 WP_004268418.1.34099 WP_004268418.1.38287 WP_004268418.1.38998 WP_004268418.1.45260 WP_004268418.1.45775 WP_004268418.1.47471 WP_004268418.1.47549 WP_004268418.1.50484 WP_004268418.1.53490 WP_004268418.1.62237 WP_004268418.1.66072 WP_004268418.1.75174 WP_004268418.1.78909 WP_004268418.1.86686 WP_004268418.1.86797 WP_004268418.1.94304 gi|384194913|ref|YP_005580658.1| gi|549471800|ref|YP_008605507.1| gi|387820221|ref|YP_006300264.1| gi|241195763|ref|YP_002969318.1| gi|384193357|ref|YP_005579103.1| gi|387821883|ref|YP_006301832.1| gi|241190357|ref|YP_002967751.1| 555970.Balat_0300 580050.Balac_0300 gi|518656749|ref|YP_008143111.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]