SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_004282124.1.51921 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_004282124.1.51921
Domain Number 1 Region: 83-177
Classification Level Classification E-value
Superfamily Ribosomal protein L6 2.36e-33
Family Ribosomal protein L6 0.0000656
Further Details:      
 
Domain Number 2 Region: 1-82
Classification Level Classification E-value
Superfamily Ribosomal protein L6 1.31e-21
Family Ribosomal protein L6 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_004282124.1.51921
Sequence length 179
Comment 50S ribosomal protein L6 [Leptospira borgpetersenii]; AA=GCF_000013945.1; RF=representative genome; TAX=355276; STAX=174; NAME=Leptospira borgpetersenii serovar Hardjo-bovis str. L550; strain=L550; AL=Complete Genome; RT=Major
Sequence
MSRIGKAEIKLPDKVEVKQENANIKVKGPLGELSTPIFEGLSVKNENGIVKLERSNEDQK
VVALHGLTRALLMNCVKGVSQGWEKNLEINGVGYRAQKRGEDLVMSLGYSHEVVYKAPKG
IKIDVQEQLKIKVTGIDKQLVGQVAADIRSKRPPEPYKGKGIKYAEEFIKKKAGKTGKK
Download sequence
Identical sequences M6BX49 M6W0G1 Q04PV3
355276.LBL_0428 355276.LBL_0468 355277.LBJ_2644 gi|116327239|ref|YP_796959.1| gi|116327279|ref|YP_796999.1| gi|116332107|ref|YP_801825.1| WP_004282124.1.14 WP_004282124.1.30409 WP_004282124.1.38848 WP_004282124.1.421 WP_004282124.1.48790 WP_004282124.1.51494 WP_004282124.1.51921 WP_004282124.1.55252 WP_004282124.1.75198 WP_004282124.1.75262 WP_004282124.1.76100 WP_004282124.1.87468 WP_004282124.1.95176

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]