SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_004292963.1.80163 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_004292963.1.80163
Domain Number 1 Region: 117-202
Classification Level Classification E-value
Superfamily PKD domain 6.41e-18
Family PKD domain 0.0011
Further Details:      
 
Domain Number 2 Region: 41-116
Classification Level Classification E-value
Superfamily PKD domain 4.32e-16
Family PKD domain 0.0017
Further Details:      
 
Domain Number 3 Region: 282-572
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0000000000000785
Family Quinoprotein alcohol dehydrogenase-like 0.013
Further Details:      
 
Weak hits

Sequence:  WP_004292963.1.80163
Domain Number - Region: 197-296
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.00322
Family Quinoprotein alcohol dehydrogenase-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_004292963.1.80163
Sequence length 609
Comment PKD domain-containing protein [Bacteroides eggerthii]; AA=GCF_000273465.1; RF=na; TAX=665953; STAX=28111; NAME=Bacteroides eggerthii 1_2_48FAA; strain=1_2_48FAA; AL=Contig; RT=Major
Sequence
MKNIAYILFSVLLIFVTSCKDEETIYHTAARPGFAVGEQYEVGESVTFTDATIPNEGTKI
VAYLWEFGDADKSTSTEQSPTFVFKKDGIYLVKLTVTDSNGLEVSSQKEITVINPTTPDF
TFDKKKYVMGDLTTFTDATTTKSGTTITSYLWEFGDEAGTTSDKQNPTFTYTEAGAYAVK
LTVTDSYGLTASITKSVTVLDPSQVIAVQWSSALNGVVKGIPSPALAKDGSAVYMLASAG
NGAPATLNAFDVTNGAAKWTFDISVGLHDAEPNVLVKDVFSSPSVGKDGSVYIVVRDLQS
ASAKRHLYTLAVDANGAKKWHQAVGGNVNLYAITPAIDADGNIYVANRKNEVFKLTSSGA
VTELASTDCPEVTGGISLAKDGTAYMFGKGNTGLYAYNTSGDNKKWLYNTDFGNASDALT
GTLRSASVTVGNDGTLYSVIDLSSGAGAVIALDPNGSLKWKYETVGAIPDGGVVLGEDGT
VYANGGKASGSNGAGVVALGSDGSLKWHYKTESDAQTVPLIDNRGYIHFITADATYYILK
PDGKLFSSQKIGDSTASSPVMDDKGNLYVSVKKDGADVMLCVTSEATSYNTNSAWPMSGQ
NPQRTGLQK
Download sequence
Identical sequences E5WV78
WP_004292963.1.80163 WP_004292963.1.90763

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]