SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_004302291.1.21574 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_004302291.1.21574
Domain Number 1 Region: 234-364,405-553
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 1.33e-20
Family Quinoprotein alcohol dehydrogenase-like 0.0038
Further Details:      
 
Domain Number 2 Region: 121-206
Classification Level Classification E-value
Superfamily PKD domain 1.15e-19
Family PKD domain 0.0021
Further Details:      
 
Domain Number 3 Region: 33-119
Classification Level Classification E-value
Superfamily PKD domain 0.0000000000000144
Family PKD domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_004302291.1.21574
Sequence length 587
Comment hypothetical protein [Bacteroides ovatus]; AA=GCF_001535615.1; RF=na; TAX=28116; STAX=28116; NAME=Bacteroides ovatus; strain=CL09T03C03; AL=Scaffold; RT=Major
Sequence
MNRMIMKKYIFLIVTVVCLFACKDGDEVRQTTSPEASFSIDKEEYTVGDIVYLTDESVKT
EGEIVEYFWHFGFEGEGNRATTKDASVLYKKAGAYVIKLTVTDEFGGYATASHTVVIRPT
NMPPVTDFSYSPAICKVNEKVQFTDKSVDEDGEVVAYEWDFGNGQTSQEKDPEITFTTTG
FVTVKLTTTDDRGATNTKQATLYVRDTSISGVTILWDKTFETSSSLRSISPAVGDNGDVY
VSSNALHLFAYSPSGEQKWMFDLSKDGGAGDQGSSPMVGADGTIYMGASTTDKNISSSLY
AIHPDGTQKWRYELGIGTNIPYISPALSRDGNILIGNRGTDGSVHMVDRSSGRQLWRRKS
PNGGANGGISVGQNGVIHSALSGANGFARTTQDGVNLSPNLGKGNTAAAVYPAIDAQGNV
YVAFSEGVVAAYDNQGNELWRYPASGTMGKIDQGGPAIGADGTIYVGTKNPNAQVVALTK
GGAKKWSYSSVAEIGTTPAIDSDGNIHICDDGGNYIILNADGTEKYKRQLGSKIWSSPVI
ADYGIVYVTYEDNGACKLIAIDCGIEGPANSPWAQRGQNAKRNALQK
Download sequence
Identical sequences A7M632
WP_004302291.1.17530 WP_004302291.1.21574 WP_004302291.1.37910 WP_004302291.1.49654 WP_004302291.1.79560 WP_004302291.1.84276 VvR69

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]