SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_004376136.1.35335 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_004376136.1.35335
Domain Number 1 Region: 224-339
Classification Level Classification E-value
Superfamily OmpA-like 3.4e-39
Family OmpA-like 0.00048
Further Details:      
 
Domain Number 2 Region: 38-181
Classification Level Classification E-value
Superfamily OMPA-like 1.39e-16
Family Outer membrane protein 0.0088
Further Details:      
 
Domain Number 3 Region: 193-225
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.000000144
Family TSP type-3 repeat 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_004376136.1.35335
Sequence length 345
Comment MULTISPECIES: porin [Pseudomonas]; AA=GCF_000691565.1; RF=na; TAX=303; STAX=303; NAME=Pseudomonas putida; strain=DLL-E4; AL=Complete Genome; RT=Major
Sequence
MKLKNTLGLAIGSLVAATSFGVLAQGQGAVEIEGNVTKQYYDSERNFKNDGTNPGVRLGY
FLTDDVSLDLGYNETHNARGEVFNKDIKGSKAKLDATYHFGTVGDALRPYVSAGFAHESL
GQATRSGRDHSTFANVGAGAKWYITDMFFARAGVEAMYNIDNGNTEWGPTVGVGLNFGGS
PKQAEVAPAPVAEVCSDSDNDGVCDNVDKCPDTPANVTVDADGCPAVAEVVRVELDVKFD
FDKSVVKPNSYGDIKNLADFMKQYPQTTTTVEGHTDSVGPDAYNQKLSERRANAVKQVLT
QQYGVESSRVDSVGYGETRPVADNATEEGRAVNRRVEAQVEAQAK
Download sequence
Identical sequences A0A059UTZ6 A0A099MY29 A0A0C1KA01 A0A136QMA3 F8FTE4 J8UUR9 L0FIJ2 V7DA23 V9UY82 V9WRA1
gi|568181070|ref|YP_008953606.1| gi|568186501|ref|YP_008959035.1| 2035966480 gi|431801566|ref|YP_007228469.1| gi|339486578|ref|YP_004701106.1| WP_004376136.1.1643 WP_004376136.1.23948 WP_004376136.1.28354 WP_004376136.1.32670 WP_004376136.1.35335 WP_004376136.1.41505 WP_004376136.1.52768 WP_004376136.1.56258 WP_004376136.1.57632 WP_004376136.1.61620 WP_004376136.1.65739 WP_004376136.1.71677 WP_004376136.1.7288 WP_004376136.1.7435 WP_004376136.1.76210 WP_004376136.1.76710 WP_004376136.1.80759 WP_004376136.1.92076 WP_004376136.1.9402 WP_004376136.1.95946 WP_004376136.1.99927

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]