SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_004398702.1.2914 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_004398702.1.2914
Domain Number 1 Region: 320-691
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 2.73e-70
Family beta-Lactamase/D-ala carboxypeptidase 0.0023
Further Details:      
 
Domain Number 2 Region: 63-123,187-319
Classification Level Classification E-value
Superfamily Penicillin binding protein dimerisation domain 7.46e-37
Family Penicillin binding protein dimerisation domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_004398702.1.2914
Sequence length 716
Comment MULTISPECIES: hypothetical protein [Bacillus]; AA=GCF_000155355.1; RF=na; TAX=535025; STAX=1423; NAME=Bacillus subtilis subsp. subtilis str. JH642; strain=JH642; AL=Chromosome; RT=Major
Sequence
MRRNKPKKQNHKEKKKSLPIRLNILFLAAFVIFTWIIVELGIKQIVQGDDYKNQANKQEQ
SEVSSAVPRGKIYDRNFNAIVTNKALNAITYTRSKSTTQEQRLKIAKKLSDMIKVDTKKV
TERDKKDYWILTRPKEAKKLISSKERQQVEDKKISDDDLYQLQLKRITDKQLNELTDKDM
QILAIKRQMDSGYALTPQYIKNEDVSAKEMAVVSEHLDELPGVDVTSDWEREYPYKNLLR
SVLGSVSSSNEGLPSNLLDHYLSLGYSRNDRVGKSYLEYQYESLLQGQKAKVENITDSKG
NVTGTKTVSEGKAGKDLVLTIDIDLQKSVEKIIEKKLKAAKARPSTELLDRAFVVMMDPR
NGEVLTMAGKQIKRENGAYKFDDYALGAMTSSYAMGSAVKGATVLTGLQTGAINLNTVFK
DEPLYIGQDKRGKKSWQNLGPVGIQTALEKSSNVFMFKTAIAVGKGEYKPHQALPLDTSA
FDTFRNYFSQFGLGVKTGIDLPNEMTGYKGTSRLSGFLLDFAIGQYDTYTPLELAQYVST
IANGGYRMKPQLVKEVRDSNAKKGIGAVVDSVQPEVLNKVDMKSSYIEEVQAGFRRVATK
GTAAGQLASASYKPAAKTGTAQSFYDGPDKSKTGTDTYNTTLVAYAPADNPEIAISVVVP
WTYIDYNQRYSITNEIGREVMDKYFELKSKQDKEGTQQKNKDKIEENAENTTSSDN
Download sequence
Identical sequences A0A164X661 A0A1B2AXC0 L8ANM5 P54488
NP_390379.1.22788 WP_004398702.1.11257 WP_004398702.1.1140 WP_004398702.1.12759 WP_004398702.1.15902 WP_004398702.1.16291 WP_004398702.1.2914 WP_004398702.1.32219 WP_004398702.1.33846 WP_004398702.1.36189 WP_004398702.1.39605 WP_004398702.1.40859 WP_004398702.1.44184 WP_004398702.1.45019 WP_004398702.1.47157 WP_004398702.1.56274 WP_004398702.1.56411 WP_004398702.1.57201 WP_004398702.1.5726 WP_004398702.1.57513 WP_004398702.1.6139 WP_004398702.1.6517 WP_004398702.1.65223 WP_004398702.1.72999 WP_004398702.1.76977 WP_004398702.1.78686 WP_004398702.1.81116 WP_004398702.1.81747 WP_004398702.1.82722 WP_004398702.1.88042 WP_004398702.1.91723 WP_004398702.1.93420 WP_004398702.1.94199 WP_004398702.1.96043 WP_004398702.1.979 gi|470162707|ref|YP_007534482.1| gi|560129453|ref|YP_008830594.1| gi|16079555|ref|NP_390379.1| 224308.BSU25000

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]