SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_004398903.1.32219 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_004398903.1.32219
Domain Number 1 Region: 188-390,424-578
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 4.13e-60
Family beta-Lactamase/D-ala carboxypeptidase 0.0031
Further Details:      
 
Domain Number 2 Region: 50-223
Classification Level Classification E-value
Superfamily Penicillin binding protein dimerisation domain 9.42e-22
Family Penicillin binding protein dimerisation domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_004398903.1.32219
Sequence length 584
Comment MULTISPECIES: penicillin-binding protein 4B [Bacillus]; AA=GCF_000497485.1; RF=na; TAX=1415167; STAX=1423; NAME=Bacillus subtilis PY79; strain=PY79; AL=Complete Genome; RT=Major
Sequence
MKISKRMKLAVIAFLIVFFLLLLRLAEIQLFFTESFSKKKINLIQESVKQRTEEVLISDG
RGSFLDRNGRALTGQSEPAVVLFPFLLTQDWPIKKVADILGMSEDDLRQTLGQAKKPVIL
QQKKIKTLSKQSITKINSLKYPGIYGVYMENEDKPSLASHTIGSTNQDPALLRKKYPDKE
SLPITTEIGTTGLERTFDEFLLPEQDTKLLYHVDGKGNPLFGMDVKYTAEANTFYPLQIK
TTIDQSIQKAMEEVLDEQGLKKGGAVLLDIENSSVLGIVSKPDADVSRQNTLQNYMLTPI
YPGSVFKTVIAAAAIENNMVKPSQTFNCNLNLYGEPGDDKGTLSFDESFAQSCNYTFTSL
AEQLMKKDSSVIEDMSEKLALTDRAGWEGKLYHETDFRQLYNEKSGVIWGDEKDKSVKKA
IAQTAIGQKNVKVTPLEVANMMATIARGGEKRQVKIAEQIEYKNGTTLVTFKDQKLKGET
IDKYTSQQLQKILRRVVESPSGTGRRFQDLPYTVAGKSGTAQTGKLSKEKETLYEKWFAG
YFPADKPKYALVVLHMDTPGDKALTNSVFYDIVKKVHEIEINQK
Download sequence
Identical sequences A0A164WZK5 A0A1B2BDM2 L8ANK9 O32032
NYSGRC-SEC-16079785 224308.BSU27310 NP_390609.1.22788 WP_004398903.1.11231 WP_004398903.1.11257 WP_004398903.1.1140 WP_004398903.1.12759 WP_004398903.1.15902 WP_004398903.1.16291 WP_004398903.1.19261 WP_004398903.1.27372 WP_004398903.1.27660 WP_004398903.1.2914 WP_004398903.1.31100 WP_004398903.1.32219 WP_004398903.1.33846 WP_004398903.1.36189 WP_004398903.1.39605 WP_004398903.1.40859 WP_004398903.1.44140 WP_004398903.1.44184 WP_004398903.1.45019 WP_004398903.1.47157 WP_004398903.1.56274 WP_004398903.1.56411 WP_004398903.1.57184 WP_004398903.1.57201 WP_004398903.1.5726 WP_004398903.1.57513 WP_004398903.1.6139 WP_004398903.1.6517 WP_004398903.1.65223 WP_004398903.1.72516 WP_004398903.1.72999 WP_004398903.1.76977 WP_004398903.1.78686 WP_004398903.1.79046 WP_004398903.1.79712 WP_004398903.1.79987 WP_004398903.1.81116 WP_004398903.1.81747 WP_004398903.1.82722 WP_004398903.1.88042 WP_004398903.1.91723 WP_004398903.1.93420 WP_004398903.1.94199 WP_004398903.1.95009 WP_004398903.1.96043 WP_004398903.1.979 gi|560129691|ref|YP_008830832.1| gi|402776883|ref|YP_006630827.1| gi|470162941|ref|YP_007534716.1| gi|16079785|ref|NP_390609.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]