SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_004449115.1.65311 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_004449115.1.65311
Domain Number 1 Region: 4-241
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.43e-23
Family Phosphate binding protein-like 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_004449115.1.65311
Sequence length 249
Comment glycine/betaine ABC transporter substrate-binding protein [Acetobacter pasteurianus]; AA=GCF_000010925.1; RF=na; TAX=634457; STAX=438; NAME=Acetobacter pasteurianus IFO 3283-32; strain=IFO 3283 substr. IFO 3283-32; AL=Complete Genome; RT=Major
Sequence
MTSLTLAYPETTVHEATAAAIIRVLEANDVEPDIVTGPKDVLTDMLKKGEVDFYVSAWLP
DEDAGMLAPGILPLGNLFRPAAHCCISAEDTPLTSLDDVAQAGPELSRTIITPASLRKHM
ENVLQQYGLDTAGFSLKVLPDEEALAELNAALKREELVLMPLFQPCFLFHIGGFRILNDP
KNALGGEQDARILIRAETKDEMEQDLLDELDELMLSAKIISAMDYAMRVEGMTADEAAEA
WQRGKLLPR
Download sequence
Identical sequences C7JH72 S6D6D0
gi|384059694|ref|YP_005498822.1| gi|529232637|ref|YP_008393452.1| gi|384042194|ref|YP_005480938.1| gi|384050711|ref|YP_005477774.1| gi|258542273|ref|YP_003187706.1| gi|384119062|ref|YP_005501686.1| gi|384053819|ref|YP_005486913.1| WP_004449115.1.36695 WP_004449115.1.37930 WP_004449115.1.38618 WP_004449115.1.45580 WP_004449115.1.55019 WP_004449115.1.62313 WP_004449115.1.64431 WP_004449115.1.65311 WP_004449115.1.71918 WP_004449115.1.88241 WP_004449115.1.96488 WP_004449115.1.99323 634452.APA01_11790 gi|384062986|ref|YP_005483628.1| gi|384057053|ref|YP_005489720.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]