SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_004456284.1.50147 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_004456284.1.50147
Domain Number 1 Region: 1-144
Classification Level Classification E-value
Superfamily RbsD-like 3.27e-46
Family RbsD-like 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_004456284.1.50147
Sequence length 145
Comment fucose isomerase [Clostridium perfringens]; AA=GCF_000013285.1; RF=representative genome; TAX=195103; STAX=1502; NAME=Clostridium perfringens ATCC 13124; strain=ATCC 13124; AL=Complete Genome; RT=Major
Sequence
MLKGVPQILSPELLKVLCEMGHSDKIVIADGNFPTESMGKECIVVRCDGHGIPELLDAIL
EVFPLDTYVENPVNLMEVMKGDNVKTPIWDEYKNIIGKHDDRGSNVISTIERFKFYEEAK
KAYAIIATGEKALYANVILQKGVVI
Download sequence
Identical sequences A0A0H2YV14 B1R9R3
WP_004456284.1.23119 WP_004456284.1.27537 WP_004456284.1.31832 WP_004456284.1.4402 WP_004456284.1.50147 WP_004456284.1.51349 gi|110801351|ref|YP_695496.1| 195103.CPF_1050

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]