SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_004459640.1.10161 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_004459640.1.10161
Domain Number 1 Region: 249-410
Classification Level Classification E-value
Superfamily CinA-like 4.84e-56
Family CinA-like 0.000079
Further Details:      
 
Domain Number 2 Region: 1-204
Classification Level Classification E-value
Superfamily Molybdenum cofactor biosynthesis proteins 1.57e-40
Family MoeA central domain-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_004459640.1.10161
Sequence length 412
Comment damage-inducible protein CinA [Clostridium perfringens]; AA=GCF_002012325.1; RF=na; TAX=1502; STAX=1502; NAME=Clostridium perfringens; strain=Del1; AL=Chromosome; RT=Major
Sequence
MKAEIMAIGTEILLGDIVNTNAQFLAKELANLGIGVYHQSVVGDNSERILEAFDNAFKNC
DTIITTGGLGPTKDDLSKELAAKYFNMEMCLREELLCDLEDYFKKNNLEMTENNKKQCYF
PKEAIILPNPNGTAPGAILEGENNKRIILLPGPPREMEPMFTNHVVPYLSKFTDSVLVSK
ILRVFGIGESKMEDLVCDLLDNENPTVAPYAKNIDVILRITAKGKNKEEAEKLISPMEKE
IRKRLGDNIYGEGEVTLEEVVGKLLVDKKMTVSTAESCTGGMVASTLINYPGISEVFMEG
AVTYSNEAKMKRLGVKKETLEDFGAVSEECAREMAKGIAKNAGTRIGISTTGIAGPGGGT
EEKPVGLVYAGLCIDGITKVKKFNFKADRQKVRTRTMMNVLDWLRRELEKID
Download sequence
Identical sequences A0A1U9V447 Q0TUU6
WP_004459640.1.10161 WP_004459640.1.2058 WP_004459640.1.50147 WP_004459640.1.98368 gi|110799435|ref|YP_694594.1| 195103.CPF_0130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]