SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_004460616.1.18401 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_004460616.1.18401
Domain Number 1 Region: 157-340
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 1.44e-68
Family Methylesterase CheB, C-terminal domain 0.000000513
Further Details:      
 
Domain Number 2 Region: 1-106
Classification Level Classification E-value
Superfamily CheY-like 1.71e-25
Family CheY-related 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_004460616.1.18401
Sequence length 343
Comment chemotaxis response regulator protein-glutamate methylesterase [Leptospira santarosai]; AA=GCF_000244575.1; RF=na; TAX=1049979; STAX=28183; NAME=Leptospira santarosai str. CBC523; strain=CBC523; AL=Contig; RT=Major
Sequence
MIRVFIIDDSAVVRQVLAQILNKDPEIEIIGFASDPIFASERLSSVWPDVFILDVEMPRM
DGISFLKKIMSERPTPVILCSTLAEKESETAVLAMKLGAIDIIEKPKIGLKNFLEESEVL
FTDSVKAASAARIKFHQDGESKENHRQTKADFSKISTTDKLIAIGTSTGGTQALEYILTQ
LDVRCPGIVIVQHMPEKFTETFANRLNQICEIQVKEAKDGDRIQLGSAYIAPGNKHMEIY
LSGAQFHVRVLDGPLINRHRPSVDVLFNSVAKIAGKNAKGIIMTGMGNDGANGLLKMRQT
GAFTIAQDETSCVVFGMPKEAILKGAVETILPLSEIVREVQIF
Download sequence
Identical sequences A0A0E2DYP1 A0A0M1YSA3 A0A1V2E6P1 K8Y100 M6JE90
WP_004460616.1.10978 WP_004460616.1.18401 WP_004460616.1.18456 WP_004460616.1.21210 WP_004460616.1.29418 WP_004460616.1.41926 WP_004460616.1.44299 WP_004460616.1.58894 WP_004460616.1.62320 WP_004460616.1.63257 WP_004460616.1.70806 WP_004460616.1.79523 WP_004460616.1.80262 WP_004460616.1.83002 WP_004460616.1.90021

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]