SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_004597730.1.61965 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_004597730.1.61965
Domain Number 1 Region: 1-367
Classification Level Classification E-value
Superfamily PLP-dependent transferases 9.52e-86
Family Cystathionine synthase-like 0.00000395
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_004597730.1.61965
Sequence length 376
Comment cysteine desulfurase [Rickettsia prowazekii]; AA=GCF_000277265.1; RF=na; TAX=1105099; STAX=782; NAME=Rickettsia prowazekii str. RpGvF24; strain=RpGvF24; AL=Complete Genome; RT=Major
Sequence
MIYLDHNATTFIDPRVKEYIISLMDKELNPSSAHTSGRFAKNIIETARSQIATSLGITMS
REYNITFTSSGTESNNLIMKNFYDGDIFISAIEHLSIYNHINYAPNIKIIRVNKQGLVDL
EHLEDLLSQSNASKKLVSVMIANNENGVLQDIAAISKITKKYNAKFHSDLVQSFGKISLN
IKELGLDFATISGHKIGGGHGCGALISNSNFQLIPIIIGGGQEKSVRSGTENVLAIAGFG
LAAEFRRKDISKNYIKIRYLQERLEQKLKEYSNVNIISNNVARLANTTLITVDNTDAQVK
LIGFDLRNICVSSGSACSSGKISKSHVLTNMGIREEEARSSIRISLSHTNTISDIKAFIK
AFEEIYEYKSSCNHCI
Download sequence
Identical sequences D5AX78 Q9ZD59
gi|383500557|ref|YP_005413917.1| gi|478693496|ref|YP_007750403.1| NP_220864.1.81248 WP_004597730.1.19079 WP_004597730.1.38548 WP_004597730.1.39958 WP_004597730.1.61965 WP_004597730.1.6643 WP_004597730.1.75108 WP_004597730.1.80123 WP_004597730.1.82014 WP_004597730.1.8209 WP_004597730.1.9355 WP_004597730.1.96644 gi|383487895|ref|YP_005405574.1| gi|383487317|ref|YP_005404997.1| gi|386082338|ref|YP_005998915.1| gi|478693010|ref|YP_007749918.1| gi|383488741|ref|YP_005406419.1| gi|383499721|ref|YP_005413082.1| gi|15604348|ref|NP_220864.1| gi|383489581|ref|YP_005407258.1| 272947.RP487

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]