SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_004599373.1.96644 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_004599373.1.96644
Domain Number 1 Region: 26-217
Classification Level Classification E-value
Superfamily Cytochrome c 1.14e-70
Family Cytochrome bc1 domain 0.00000452
Further Details:      
 
Domain Number 2 Region: 218-253
Classification Level Classification E-value
Superfamily Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor 0.0000124
Family Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_004599373.1.96644
Sequence length 253
Comment cytochrome c [Rickettsia prowazekii]; AA=GCF_000277225.1; RF=na; TAX=1105097; STAX=782; NAME=Rickettsia prowazekii str. Dachau; strain=Dachau; AL=Chromosome; RT=Major
Sequence
MKILISIILLVTSSLNINAEALRPETLHLKKMKWPFDGVFGTVNREAAQRGFQVYKEVCS
VCHGLNNLYYRNLKDIGFSDDEIKEIAKGYTVKDGPNDDGEMFERPALPYDRFVPPYPNE
QAARKANNGANPPDLSLIIKARYDGANYIYSLLTSYTEPPAYFKMMHGTYYNPYFPGAQI
AMPPPLTDGQVTYMDGTNASVEQMSKDVTVFLQWAAEPEMEHRKSMGLKVMMFLIVFTIL
FYIAKNRIWSNVK
Download sequence
Identical sequences D5AWJ6 Q9ZDQ4
gi|383489377|ref|YP_005407054.1| gi|383487690|ref|YP_005405369.1| 272947.RP272 gi|383499514|ref|YP_005412875.1| gi|386082106|ref|YP_005998683.1| gi|15604142|ref|NP_220657.1| NP_220657.1.81248 WP_004599373.1.19079 WP_004599373.1.38548 WP_004599373.1.39958 WP_004599373.1.6643 WP_004599373.1.75108 WP_004599373.1.82014 WP_004599373.1.8209 WP_004599373.1.9355 WP_004599373.1.96644 gi|383488536|ref|YP_005406214.1| gi|478693717|ref|YP_007750624.1| gi|478693248|ref|YP_007750156.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]